KEGG   Homo sapiens (human): 284532Help
Entry
284532            CDS       T01001                                 

Gene name
OR14A16, OR5AT1
Definition
olfactory receptor, family 14, subfamily A, member 16
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    284532 (OR14A16)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    284532 (OR14A16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 309 aa AA seqDB search
MANLTIVTEFILMGFSTNKNMCILHSILFLLIYLCALMGNVLIIMITTLDHHLHTPVYFF
LKNLSFLDLCLISVTAPKSIANSLIHNNSISFLGCVSQVFLLLSSASAELLLLTVMSFDR
YTAICHPLHYDVIMDRSTCVQRATVSWLYGGLIAVMHTAGTFSLSYCGSNMVHQFFCDIP
QLLAISCSENLIREIALILINVVLDFCCFIVIIITYVHVFSTVKKIPSTEGQSKAYSICL
PHLLVVLFLSTGFIAYLKPASESPSILDAVISVFYTMLPPTFNPIIYSLRNKAIKVALGM
LIKGKLTKK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatctcacaatcgtgactgaatttatccttatggggttttctaccaataaaaat
atgtgcattttgcattcgattctcttcttgttgatttatttgtgtgccctgatggggaat
gtcctcattatcatgatcacaactttggaccatcatctccacacccccgtgtatttcttc
ttgaagaatctatctttcttggatctctgccttatttcagtcacggctcccaaatctatc
gccaattctttgatacacaacaactccatttcattccttggctgtgtttcccaggtcttt
ttgttgctttcttcagcatctgcagagctgctcctcctcacggtgatgtcctttgaccgc
tatactgctatatgtcaccctctgcactatgatgtcatcatggacaggagcacctgtgtc
caaagagccactgtgtcttggctgtatgggggtctgattgctgtgatgcacacagctggc
accttctccttatcctactgtgggtccaacatggtccatcagttcttctgtgacattccc
cagttattagctatttcttgctcagaaaatttaataagagaaattgcactcatccttatt
aatgtagttttggatttctgctgttttattgtcatcatcattacctatgtccacgtcttc
tctacagtcaagaagatcccttccacagaaggccagtcaaaagcctactctatttgcctt
ccacacttgctggttgtgttatttctttccactggattcattgcttatctgaagccagct
tcagagtctccttctattttggatgctgtaatttctgtgttctacactatgctgccccca
acctttaatcccattatatacagtttgagaaacaaggccataaaggtggctctggggatg
ttgataaagggaaagctcaccaaaaagtaa

DBGET integrated database retrieval system