KEGG   Homo sapiens (human): 284541Help
Entry
284541            CDS       T01001                                 

Gene name
CYP4A22
Definition
cytochrome P450, family 4, subfamily A, polypeptide 22 (EC:1.14.15.3)
Orthology
K17688  
alkane 1-monooxygenase [EC:1.14.15.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    284541 (CYP4A22)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    284541 (CYP4A22)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.3  alkane 1-monooxygenase
     284541 (CYP4A22)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   284541 (CYP4A22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p33
AA seq 519 aa AA seqDB search
MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLF
GHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
KFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHEND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL
LPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctgtcctgagccccagcagacgcctgggtggtgtctccgggatcctccaa
gtgacctccctgctcattctgcttctgctgctgatcaaggcagctcagctctacctgcat
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagttccaacacgaccaggagctacaacggattcaggaacgggtgaag
acattcccaagtgcctgtccttattggatatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggatcctac
aaattcctggctccacggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccacaatgacatcctgaagccatacgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagagt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatccaggcc
attagtgacctgaacagcctggttttttgctgtatgaggaatgcctttcatgagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcacttggattttctggacatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccatggcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggaagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacctagaggtgtttgacccttcccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaaccagctgaaggtggccagggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccatggcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

DBGET integrated database retrieval system