KEGG   Homo sapiens (human): 2847Help
Entry
2847              CDS       T01001                                 

Gene name
MCHR1, GPR24, MCH-1R, MCH1R, SLC-1, SLC1
Definition
(RefSeq) melanin concentrating hormone receptor 1
  KO
K04320  
melanin-concentrating hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2847 (MCHR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Melanin-concentrating hormone
    2847 (MCHR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.2
AA seq 422 aa AA seqDB search
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgggagccatgaagaagggagtggggagggcagttgggcttggaggcggcagc
ggctgccaggctacggaggaagacccccttcccaactgcggggcttgcgctccgggacaa
ggtggcaggcgctggaggctgccgcagcctgcgtgggtggaggggagctcagctcggttg
tgggagcaggcgaccggcactggctggatggacctggaagcctcgctgctgcccactggt
cccaacgccagcaacacctctgatggccccgataacctcacttcggcaggatcacctcct
cgcacggggagcatctcctacatcaacatcatcatgccttcggtgttcggcaccatctgc
ctcctgggcatcatcgggaactccacggtcatcttcgcggtcgtgaagaagtccaagctg
cactggtgcaacaacgtccccgacatcttcatcatcaacctctcggtagtagatctcctc
tttctcctgggcatgcccttcatgatccaccagctcatgggcaatggggtgtggcacttt
ggggagaccatgtgcaccctcatcacggccatggatgccaatagtcagttcaccagcacc
tacatcctgaccgccatggccattgaccgctacctggccactgtccaccccatctcttcc
acgaagttccggaagccctctgtggccaccctggtgatctgcctcctgtgggccctctcc
ttcatcagcatcacccctgtgtggctgtatgccagactcatccccttcccaggaggtgca
gtgggctgcggcatacgcctgcccaacccagacactgacctctactggttcaccctgtac
cagtttttcctggcctttgccctgccttttgtggtcatcacagccgcatacgtgaggatc
ctgcagcgcatgacgtcctcagtggcccccgcctcccagcgcagcatccggctgcggaca
aagagggtgacccgcacagccatcgccatctgtctggtcttctttgtgtgctgggcaccc
tactatgtgctacagctgacccagttgtccatcagccgcccgaccctcacctttgtctac
ttatacaatgcggccatcagcttgggctatgccaacagctgcctcaacccctttgtgtac
atcgtgctctgtgagacgttccgcaaacgcttggtcctgtcggtgaagcctgcagcccag
gggcagcttcgcgctgtcagcaacgctcagacggctgacgaggagaggacagaaagcaaa
ggcacctga

DBGET integrated database retrieval system