KEGG   Homo sapiens (human): 2850Help
Entry
2850              CDS       T01001                                 

Gene name
GPR27, SREB1
Definition
(RefSeq) G protein-coupled receptor 27
  KO
K04301  
G protein-coupled receptor 27
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   SREB
    2850 (GPR27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3p21-p14
AA seq 375 aa AA seqDB search
MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDL
CLADGLRALACLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTR
YLAIAHHRFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGA
PGALGFLLLLAVVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATGQAAA
NWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAVTLLFLLLWGPY
VVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCCQSPR
TTQATHPCDLKGIGL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgcgagcgagccgggtggcagcggcggcggcgaggcggccgccctgggcctc
aagctggccacgctcagcctgctgctgtgcgtgagcctagcgggcaacgtgctgttcgcg
ctgctgatcgtgcgggagcgcagcctgcaccgcgccccgtactacctgctgctcgacctg
tgcctggccgacgggctgcgcgcgctcgcctgcctcccggccgtcatgctggcggcgcgg
cgtgcggcggccgcggcgggggcgccgccgggcgcgctgggctgcaagctgctcgccttc
ctggccgcgctcttctgcttccacgccgccttcctgctgctgggcgtgggcgtcacccgc
tacctggccatcgcgcaccaccgcttctatgcagagcgcctggccggctggccgtgcgcc
gccatgctggtgtgcgccgcctgggcgctggcgctggccgcggccttcccgccagtgctg
gacggcggtggcgacgacgaggacgcgccgtgcgccctggagcagcggcccgacggcgcc
cccggcgcgctgggcttcctgctgctgctggccgtggtggtgggcgccacgcacctcgtc
tacctccgcctgctcttcttcatccacgaccgccgcaagatgcggcccgcgcgcctggtg
cccgccgtcagccacgactggaccttccacggcccgggcgccaccggccaggcggccgcc
aactggacggcgggcttcggccgcgggcccacgccgcccgcgcttgtgggcatccggccc
gcagggccgggccgcggcgcgcgccgcctcctcgtgctggaagaattcaagacggagaag
aggctgtgcaagatgttctacgccgtcacgctgctcttcctgctcctctgggggccctac
gtcgtggccagctacctgcgggtcctggtgcggcccggcgccgtcccccaggcctacctg
acggcctccgtgtggctgaccttcgcgcaggccggcatcaaccccgtcgtgtgcttcctc
ttcaacagggagctgagggactgcttcagggcccagttcccctgctgccagagcccccgg
accacccaggcgacccatccctgcgacctgaaaggcattggtttatga

DBGET integrated database retrieval system