KEGG   Homo sapiens (human): 285126Help
Entry
285126            CDS       T01001                                 

Gene name
DNAJC5G, CSP-gamma
Definition
DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
Orthology
K09525  
DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    285126 (DNAJC5G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 189 aa AA seqDB search
MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRY
HPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILN
SCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFR
SEENSEDDF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtgaaggaagcagcacaccggctgtccaaaagtgagatgagcctctatgca
gtgctggatcttaagaagggcgcctcacctgaagacttcaaaaaatcctacagccattcc
gcattgcttccccaccctccttttgagtatcacctgggtaggaaactggccttgcggtat
catcccgacaagaatccagggaatgctcaagcagcagaaatattcaaagagatcaacgca
gctcatgccatactgagcgactctaagaagcggaaaatttacgaccagcatggctcattg
ggaatatatctgtatgatcactttggtgaagaaggcgtcagatactattttattctgaat
agttgttggttcaagacacttgtcatcctgtgtactctgctcacttgttgctgtttttgt
tgttgctgctgtttttgctgtggagcacttaaaccaccacctgagcaggatagtgggaga
aaatatcagcagaatgtccagagtcagcctccaaggtcaggagccaaatgtgattttaga
agcgaggaaaatagcgaagatgatttttaa

DBGET integrated database retrieval system