KEGG   Homo sapiens (human): 285126Help
Entry
285126            CDS       T01001                                 

Gene name
DNAJC5G, CSP-gamma
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5 gamma
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    285126 (DNAJC5G)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   285126 (DNAJC5G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-GeneID: 285126
NCBI-ProteinID: NP_001290056
OMIM: 613946
HGNC: 24844
Ensembl: ENSG00000163793
Vega: OTTHUMG00000097079
Pharos: Q8N7S2(Tdark)
UniProt: Q8N7S2
Position
2p23.3
AA seq 189 aa AA seqDB search
MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRY
HPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILN
SCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFR
SEENSEDDF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtgaaggaagcagcacaccggctgtccaaaagtgagatgagcctctatgca
gtgctggatcttaagaagggcgcctcacctgaagacttcaaaaaatcctacagccattcc
gcattgcttccccaccctccttttgagtatcacctgggtaggaaactggccttgcggtat
catcccgacaagaatccagggaatgctcaagcagcagaaatattcaaagagatcaacgca
gctcatgccatactgagcgactctaagaagcggaaaatttacgaccagcatggctcattg
ggaatatatctgtatgatcactttggtgaagaaggcgtcagatactattttattctgaat
agttgttggttcaagacacttgtcatcctgtgtactctgctcacttgttgctgtttctgt
tgttgctgctgtttttgctgtggagcacttaaaccaccacctgagcaggatagtgggaga
aaatatcagcagaatgtccagagtcagcctccaaggtcaggagccaaatgtgattttaga
agcgaggaaaatagcgaagatgatttttaa

DBGET integrated database retrieval system