KEGG   Homo sapiens (human): 28514Help
Entry
28514             CDS       T01001                                 

Gene name
DLL1, DELTA1, DL1, Delta
Definition
delta-like 1 (Drosophila)
Orthology
K06051  
delta
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    28514 (DLL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q27
AA seq 723 aa AA seqDB search
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtcggtgcgcgctggccctggcggtgctctcggccttgctgtgtcaggtctgg
agctctggggtgttcgaactgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccaccgccgtgcgcctgccggaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagccgccctgcacctacggc
agcgccgtcacccccgtgctgggcgtcgactccttcagtctgcccgacggcgggggcgcc
gactccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tctctgattattgaagctctccacacagattctcctgatgacctcgcaacagaaaaccca
gaaagactcatcagccgcctggccacccagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacggacctcaagtactcctaccgcttcgtgtgtgac
gaacactactacggagagggctgctccgttttctgccgtccccgggacgatgccttcggc
cacttcacctgtggggagcgtggggagaaagtgtgcaaccctggctggaaagggccctac
tgcacagagccgatctgcctgcctggatgtgatgagcagcatggattttgtgacaaacca
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgacgagtgtatccgctat
ccaggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggagccacctgcaccaacacgggccaggggagctacacttgctcttgccggcctgggtac
acaggtgccacctgcgagctggggattgacgagtgtgaccccagcccttgtaagaacgga
gggagctgcacggatctcgagaacagctactcctgtacctgcccacccggcttctacggc
aaaatctgtgaattgagtgccatgacctgtgcggacggcccttgctttaacgggggtcgg
tgctcagacagccccgatggagggtacagctgccgctgccccgtgggctactccggcttc
aactgtgagaagaaaattgactactgcagctcttcaccctgttctaatggtgccaagtgt
gtggacctcggtgatgcctacctgtgccgctgccaggccggcttctcggggaggcactgt
gacgacaacgtggacgactgcgcctcctccccgtgcgccaacgggggcacctgccgggat
ggcgtgaacgacttctcctgcacctgcccgcctggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgcgagcacgcaccctgccacaatggggccacctgccacgagaggggc
caccgctatgtgtgcgagtgtgcccgaggctacgggggtcccaactgccagttcctgctc
cccgagctgcccccgggcccagcggtggtggacctcactgagaagctagagggccagggc
gggccattcccctgggtggccgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgctgtggtggtctgcgtccggctgaggctgcagaagcaccggcccccagcc
gacccctgccggggggagacggagaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcatcatcggggccacgcagatcaagaacaccaacaagaaggcggac
ttccacggggaccacagcgccgacaagaatggcttcaaggcccgctacccagcggtggac
tataacctcgtgcaggacctcaagggtgacgacaccgccgtcagggacgcgcacagcaag
cgtgacaccaagtgccagccccagggctcctcaggggaggagaaggggaccccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggactcgggctgttcaacttcaaaa
gacaccaagtaccagtcggtgtacgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

DBGET integrated database retrieval system