KEGG   Homo sapiens (human): 285195Help
Entry
285195            CDS       T01001                                 

Gene name
SLC9A9, AUTS16, NHE9
Definition
(RefSeq) solute carrier family 9 member A9
  KO
K14725  solute carrier family 9 (sodium/hydrogen exchanger), member 9
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   285195 (SLC9A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-GeneID: 285195
NCBI-ProteinID: NP_775924
OMIM: 608396
HGNC: 20653
Ensembl: ENSG00000181804
Vega: OTTHUMG00000159373
Pharos: Q8IVB4(Tbio)
UniProt: Q8IVB4
Position
3q24
AA seq 645 aa AA seqDB search
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGL
IMGLILRYATAPTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQG
NAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLI
MYGFVKAMIHAGQLKNGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGES
VLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLGIFAGSFAMGSAYAIITALLT
KFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKIR
TKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGT
TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPI
LTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCS
PPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggagagacagtcaagggttatgtcagaaaaggatgagtatcagtttcaacatcaggga
gcggtggagctgcttgtcttcaattttttgctcatccttaccattttgacaatctggtta
tttaaaaatcatcgattccgcttcttgcatgaaactggaggagcaatggtgtatggcctt
ataatgggactaattttacgatatgctacagcaccaactgatattgaaagtggaactgtc
tatgactgtgtaaaactaactttcagtccatcaactctgctggttaatatcactgaccaa
gtttatgaatataaatacaaaagagaaataagtcagcacaacatcaatcctcatcaagga
aatgctatacttgaaaagatgacatttgatccagaaatcttcttcaatgttttactgcca
ccaattatatttcatgcaggatatagtctaaagaagagacacttttttcaaaacttagga
tctattttaacgtatgccttcttgggaactgccatctcctgcatcgtcatagggttaatt
atgtatggttttgtgaaggctatgatacatgctggccagctgaaaaatggagactttcat
ttcactgactgtttattttttggttcactgatgtctgctacagatccagtgacagtgctg
gccattttccatgaactgcacgtcgaccctgacctgtacacactcttgtttggagagagt
gtgttgaatgatgcagtggccatagtccttacatattctatatccatttacagtcccaag
gagaatccaaatgcatttgatgccgcagcattcttccagtctgtggggaatttcctggga
atcttcgctggctcatttgcaatggggtctgcgtatgccatcatcacagcactgttgacc
aaatttaccaagctgtgtgagttcccgatgctggaaaccggcctgtttttcctgctttct
tggagtgccttcctgtctgccgaggctgccggcctaacagggatagttgctgttctcttc
tgtggagtcacacaagcacattatacctacaacaatctgtcttcggattccaaaataaga
actaaacagttgtttgaatttatgaactttttggcggagaacgtcatcttctgttacatg
ggcctggcactgttcacgttccagaatcatatctttaatgctctttttatacttggagcc
tttctagcaatttttgttgccagagcctgcaacatatatcccctctccttcctcctgaat
ctaggccgaaaacagaagatcccctggaactttcagcacatgatgatgttttcaggtttg
cgaggagcgatcgcatttgccttagctattcggaacacagaatctcagcccaaacaaatg
atgtttaccactacgctgctcctcgtgttcttcactgtctgggtatttggaggaggaaca
acccccatgttgacttggcttcagatcagagttggcgtggacctggatgaaaatctgaag
gaggacccctcctcacaacaccaggaagcaaataacttggataaaaacatgacgaaagca
gagagtgctcggctcttcagaatgtggtatagctttgaccacaagtatctgaaaccaatt
ttaacccactctggtcctccgctgactacaacattacctgaatggtgtggtccgatttcc
aggctgcttaccagtcctcaagcctatggggaacagctaaaagaggatgatgtggaatgc
attgtaaaccaggatgaactagccataaattaccaggagcaagcctcctcaccctgcagt
cctcctgcaaggctaggtctggaccagaaagcttcaccccagacgccaggcaaggaaaac
atttatgagggagacctcggcctgggaggctatgaactcaagcttgagcaaactttgggt
caatcccagttgaattaa

DBGET integrated database retrieval system