KEGG   Homo sapiens (human): 285195Help
Entry
285195            CDS       T01001                                 

Gene name
SLC9A9, AUTS16, NHE9
Definition
(RefSeq) solute carrier family 9 member A9
  KO
K14725  
solute carrier family 9 (sodium/hydrogen exchanger), member 9
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   285195 (SLC9A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24
AA seq 645 aa AA seqDB search
MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGL
IMGLILRYATAPTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQG
NAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLI
MYGFVKAMIHAGQLKNGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGES
VLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLGIFAGSFAMGSAYAIITALLT
KFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKIR
TKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGT
TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPI
LTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCS
PPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggagagacagtcaagggttatgtcagaaaaggatgagtatcagtttcaacatcaggga
gcggtggagctgcttgtcttcaattttttgctcatccttaccattttgacaatctggtta
tttaaaaatcatcgattccgcttcttgcatgaaactggaggagcaatggtgtatggcctt
ataatgggactaattttacgatatgctacagcaccaactgatattgaaagtggaactgtc
tatgactgtgtaaaactaactttcagtccatcaactctgctggttaatatcactgaccaa
gtttatgaatataaatacaaaagagaaataagtcagcacaacatcaatcctcatcaagga
aatgctatacttgaaaagatgacatttgatccagaaatcttcttcaatgttttactgcca
ccaattatatttcatgcaggatatagtctaaagaagagacacttttttcaaaacttagga
tctattttaacgtatgccttcttgggaactgccatctcctgcatcgtcatagggttaatt
atgtatggttttgtgaaggctatgatacatgctggccagctgaaaaatggagactttcat
ttcactgactgtttattttttggttcactgatgtctgctacagatccagtgacagtgctg
gccattttccatgaactgcacgtcgaccctgacctgtacacactcttgtttggagagagt
gtgttgaatgatgcagtggccatagtccttacatattctatatccatttacagtcccaag
gagaatccaaatgcatttgatgccgcagcattcttccagtctgtggggaatttcctggga
atcttcgctggctcatttgcaatggggtctgcgtatgccatcatcacagcactgttgacc
aaatttaccaagctgtgtgagttcccgatgctggaaaccggcctgtttttcctgctttct
tggagtgccttcctgtctgccgaggctgccggcctaacagggatagttgctgttctcttc
tgtggagtcacacaagcacattatacctacaacaatctgtcttcggattccaaaataaga
actaaacagttgtttgaatttatgaactttttggcggagaacgtcatcttctgttacatg
ggcctggcactgttcacgttccagaatcatatctttaatgctctttttatacttggagcc
tttctagcaatttttgttgccagagcctgcaacatatatcccctctccttcctcctgaat
ctaggccgaaaacagaagatcccctggaactttcagcacatgatgatgttttcaggtttg
cgaggagcgatcgcatttgccttagctattcggaacacagaatctcagcccaaacaaatg
atgtttaccactacgctgctcctcgtgttcttcactgtctgggtatttggaggaggaaca
acccccatgttgacttggcttcagatcagagttggcgtggacctggatgaaaatctgaag
gaggacccctcctcacaacaccaggaagcaaataacttggataaaaacatgacgaaagca
gagagtgctcggctcttcagaatgtggtatagctttgaccacaagtatctgaaaccaatt
ttaacccactctggtcctccgctgactacaacattacctgaatggtgtggtccgatttcc
aggctgcttaccagtcctcaagcctatggggaacagctaaaagaggatgatgtggaatgc
attgtaaaccaggatgaactagccataaattaccaggagcaagcctcctcaccctgcagt
cctcctgcaaggctaggtctggaccagaaagcttcaccccagacgccaggcaaggaaaac
atttatgagggagacctcggcctgggaggctatgaactcaagcttgagcaaactttgggt
caatcccagttgaattaa

DBGET integrated database retrieval system