KEGG   Homo sapiens (human): 2852Help
Entry
2852              CDS       T01001                                 

Gene name
GPER1, CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR, mER
Definition
(RefSeq) G protein-coupled estrogen receptor 1
  KO
K04246  
G protein-coupled receptor 30
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2852 (GPER1)
 Human Diseases
  Drug resistance
   01522 Endocrine resistance
    2852 (GPER1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    2852 (GPER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p22.3
AA seq 375 aa AA seqDB search
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH
ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI
PDSTEQSDVRFSSAV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgacttcccaagcccggggcgtgggcctggagatgtacccaggcaccgcgcag
cctgcggcccccaacaccacctcccccgagctcaacctgtcccacccgctcctgggcacc
gccctggccaatgggacaggtgagctctcggagcaccagcagtacgtgatcggcctgttc
ctctcgtgcctctacaccatcttcctcttccccatcggctttgtgggcaacatcctgatc
ctggtggtgaacatcagcttccgcgagaagatgaccatccccgacctgtacttcatcaac
ctggcggtggcggacctcatcctggtggccgactccctcattgaggtgttcaacctgcac
gagcggtactacgacatcgccgtcctgtgcaccttcatgtcgctcttcctgcaggtcaac
atgtacagcagcgtcttcttcctcacctggatgagcttcgaccgctacatcgccctggcc
agggccatgcgctgcagcctgttccgcaccaagcaccacgcccggctgagctgtggcctc
atctggatggcatccgtgtcagccacgctggtgcccttcaccgccgtgcacctgcagcac
accgacgaggcctgcttctgtttcgcggatgtccgggaggtgcagtggctcgaggtcacg
ctgggcttcatcgtgcccttcgccatcatcggcctgtgctactccctcattgtccgggtg
ctggtcagggcgcaccggcaccgtgggctgcggccccggcggcagaaggcgctccgcatg
atcctcgcggtggtgctggtcttcttcgtctgctggctgccggagaacgtcttcatcagc
gtgcacctcctgcagcggacgcagcctggggccgctccctgcaagcagtctttccgccat
gcccaccccctcacgggccacattgtcaacctcgccgccttctccaacagctgcctaaac
cccctcatctacagctttctcggggagaccttcagggacaagctgaggctgtacattgag
cagaaaacaaatttgccggccctgaaccgcttctgtcacgctgccctgaaggccgtcatt
ccagacagcaccgagcagtcggatgtgaggttcagcagtgccgtgtag

DBGET integrated database retrieval system