KEGG   Homo sapiens (human): 285242Help
Entry
285242            CDS       T01001                                 

Gene name
HTR3E, 5-HT3-E, 5-HT3E, 5-HT3c1
Definition
(RefSeq) 5-hydroxytryptamine receptor 3E
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829 D07129
Azasetron (DG01521): D01613 D07481
Batanopride hydrochloride: D03060
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725 D07867
Fabesetron hydrochloride: D01838
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Mirtazapine (DG02838): D00563 D11056
Ondansetron (DG00060): D00456 D00678
Palonosetron (DG00064): D05343 D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016 D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185
Zacopride hydrochloride: D06353
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    285242 (HTR3E)
  Sensory system
   04742 Taste transduction
    285242 (HTR3E)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Serotonin (5-HT3)
   285242 (HTR3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 285242
NCBI-ProteinID: NP_001243542
OMIM: 610123
HGNC: 24005
Ensembl: ENSG00000186038
Vega: OTTHUMG00000156857
Pharos: A5X5Y0(Tchem)
UniProt: A5X5Y0
Position
3q27.1
AA seq 456 aa AA seqDB search
MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNI
SVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNL
WLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTF
SSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFY
VAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLL
PTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRC
CPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS
VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaagctggttccacaggaaaagattttccttctacctccttctcggttttctg
cttcaaggaaggggcgttactttcaccatcaattgctcagggtttggccagcacggggcg
gatcccactgctctgaattcagtgtttaatagaaagcccttccgtccggtcaccaacatc
agcgtccccacccaagtcaacatctccttcgcgatgtctgccatcctagatgtgaatgaa
cagctgcacctcttgtcatcattcctgtggctggaaatggtttgggataacccatttatc
agctggaacccagaggaatgtgagggcatcacgaagatgagtatggcagccaagaacctg
tggctcccagacattttcatcattgaactcatggatgtggataagaccccaaaaggcctc
acagcatatgtaagtaatgaaggtcgcatcaggtataagaaacccatgaaggtggacagt
atctgtaacctggacatcttctacttccccttcgaccagcagaactgcacactcaccttc
agctcattcctctacacagtggacagcatgttgctggacatggagaaagaagtgtgggaa
ataacagacgcatcccggaacatccttcagacccatggagaatgggagctcctgggcctc
agcaaggccaccgcaaagttgtccaggggaggcaacctgtatgatcagatcgtgttctat
gtggccatcaggcgcaggcccagtctctatgtcataaaccttctcgtgcccagtggcttt
ctggttgccatcgatgccctcagcttctacctgccagtgaaaagtgggaatcgtgtccca
ttcaagataacgctcctgctgggctacaacgtcttcctgctcatgatgagtgacttgctc
cccaccagtggcacccccctcatcggtgtctacttcgccctgtgcctgtccctgatggtg
ggcagcctgctggagaccatcttcatcacccacctgctgcacgtggccaccacccagccc
ccacccctgcctcggtggctccactccctgctgctccactgcaacagcccggggagatgc
tgtcccactgcgccccagaaggaaaataagggcccgggtctcacccccacccacctgccc
ggtgtgaaggagccagaggtatcagcagggcagatgccgggccctgcggaggcagagctg
acagggggctcagaatggacaagggcccagcgggaacacgaggcccagaagcagcactca
gtggagctgtggttgcagttcagccacgcgatggacgccatgctcttccgcctctacctg
ctcttcatggcctcctctatcatcaccgtcatatgcctctggaacacctag

DBGET integrated database retrieval system