KEGG   Homo sapiens (human): 2853Help
Entry
2853              CDS       T01001                                 

Gene name
GPR31, 12-HETER, HETER, HETER1
Definition
(RefSeq) G protein-coupled receptor 31
  KO
K08406  
G protein-coupled receptor 31
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   GPR
    2853 (GPR31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6q27
AA seq 319 aa AA seqDB search
MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALAD
LLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPR
LKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEA
LSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFL
ARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTL
RGKGQAAEPPDFNPRDSYS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccattcccaaactgctcagcccccagcactgtggtggccacagctgtgggtgtcttg
ctggggctggagtgtgggctgggtctgctgggcaacgcggtggcgctgtggaccttcctg
ttccgggtcagggtgtggaagccgtacgctgtctacctgctcaacctggccctggctgac
ctgctgttggctgcgtgcctgcctttcctggccgccttctacctgagcctccaggcttgg
catctgggccgtgtgggctgctgggccctgcacttcctgctggacctcagccgcagcgtg
gggatggccttcctggccgccgtggctttggaccggtacctccgtgtggtccaccctcgg
cttaaggtcaacctgctgtctcctcaggcggccctgggggtctcgggcctcgtctggctc
ctgatggtcgccctcacctgcccgggcttgctcatctctgaggccgcccagaactccacc
aggtgccacagtttctactccagggcagacggctccttcagcatcatctggcaggaagca
ctctcctgccttcagtttgtcctcccctttggcctcatcgtgttctgcaatgcaggcatc
atcagggctctccagaaaagactccgggagcctgagaaacagcccaagcttcagcgggcc
caggcactggtcaccttggtggtggtgctgtttgctctgtgctttctgccctgcttcctg
gccagagtcctgatgcacatcttccagaatctggggagctgcagggccctttgtgcagtg
gctcatacctcggatgtcacgggcagcctcacctacctgcacagtgtgctcaaccccgtg
gtatactgcttctccagccccaccttcaggagctcctatcggagggtcttccacaccctc
cgaggcaaagggcaggcagcagagcccccagatttcaaccccagagactcctattcctga

DBGET integrated database retrieval system