KEGG   Homo sapiens (human): 285362Help
Entry
285362            CDS       T01001                                 

Gene name
SUMF1, AAPA3037, FGE, UNQ3037
Definition
(RefSeq) sulfatase modifying factor 1
  KO
K13444  
sulfatase modifying factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00272  
Multiple sulfatase deficiency (MSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    285362 (SUMF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NBK3(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p26.1
AA seq 374 aa AA seqDB search
MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGA
HGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
IDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWW
LPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLH
NRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWE
WTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASN
LGFRCAADRLPTMD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcccgcactagggctggtgtgtggacgttgccctgagctgggtctcgtcctc
ttgctgctgctgctctcgctgctgtgtggagcggcagggagccaggaggccgggaccggt
gcgggcgcggggtcccttgcgggttcttgcggctgcggcacgccccagcggcctggcgcc
catggcagttcggcagccgctcaccgatactcgcgggaggctaacgctccgggccccgta
cccggagagcggcaactcgcgcactcaaagatggtccccatccctgctggagtatttaca
atgggcacagatgatcctcagataaagcaggatggggaagcacctgcgaggagagttact
attgatgccttttacatggatgcctatgaagtcagtaatactgaatttgagaagtttgtg
aactcaactggctatttgacagaggctgagaagtttggcgactcctttgtctttgaaggc
atgttgagtgagcaagtgaagaccaatattcaacaggcagttgcagctgctccctggtgg
ttacctgtgaaaggcgctaactggagacacccagaagggcctgactctactattctgcac
aggccggatcatccagttctccatgtgtcctggaatgatgcggttgcctactgcacttgg
gcagggaagcggctgcccacggaagctgagtgggaatacagctgtcgaggaggcctgcat
aatagacttttcccctggggcaacaaactgcagcccaaaggccagcattatgccaacatt
tggcagggcgagtttccggtgaccaacactggtgaggatggcttccaaggaactgcgcct
gttgatgccttccctcccaatggttatggcttatacaacatagtggggaacgcatgggaa
tggacttcagactggtggactgttcatcattctgttgaagaaacgcttaacccaaaaggt
cccccttctgggaaagaccgagtgaagaaaggtggatcctacatgtgccataggtcttat
tgttacaggtatcgctgtgctgctcggagccagaacacacctgatagctctgcttcgaat
ctgggattccgctgtgcagccgaccgcctgcccactatggactga

DBGET integrated database retrieval system