KEGG   Homo sapiens (human): 285440Help
Entry
285440            CDS       T01001                                 

Gene name
CYP4V2, BCD, CYP4AH1
Definition
cytochrome P450, family 4, subfamily V, polypeptide 2
Orthology
K07427  
cytochrome P450, family 4, subfamily V
Organism
hsa  Homo sapiens (human)
Disease
H00825  
Familial flecked retina syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q35.2
AA seq 525 aa AA seqDB search
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLV
GHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDK
SSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH
INQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLW
LDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL
DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELD
DVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV
IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
LSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcggggctctggctggggctcgtgtggcagaagctgctgctgtggggcgcggcgagt
gccctttccctggccggcgccagtctggtcctgagcctgctgcagagggtggcgagctac
gcgcggaaatggcagcagatgcggcccatccccacggtggcccgcgcctacccactggtg
ggccacgcgctgctgatgaagccggacgggcgagaattttttcagcagatcattgagtac
acagaggaataccgccacatgccgctgctgaagctctgggtcgggccagtgcccatggtg
gccctttataatgcagaaaatgtggaggtaattttaactagttcaaagcaaattgacaaa
tcctctatgtacaagtttttagaaccatggcttggcctaggacttcttacaagtactgga
aacaaatggcgctccaggagaaagatgttaacacccactttccattttaccattctggaa
gatttcttagatatcatgaatgaacaagcaaatatattggttaagaaacttgaaaaacac
attaaccaagaagcatttaactgctttttttacatcactctttgtgccttagatatcatc
tgtgaaacagctatggggaagaatattggtgctcaaagtaatgatgattccgagtatgtc
cgtgcagtttatagaatgagtgagatgatatttcgaagaataaagatgccctggctttgg
cttgatctctggtaccttatgtttaaagaaggatgggaacacaaaaagagccttcagatc
ctacatacttttaccaacagtgtcatcgctgaacgggccaatgaaatgaacgccaatgaa
gactgtagaggtgatggcaggggctctgccccctccaaaaataaacgcagggcctttctt
gacttgcttttaagtgtgactgatgacgaagggaacaggctaagtcatgaagatattcga
gaagaagttgacaccttcatgtttgaggggcacgatacaactgcagctgcaataaactgg
tccttatacctgttgggttctaacccagaagtccagaaaaaagtggatcatgaattggat
gacgtgtttgggaagtctgaccgtcccgctacagtagaagacctgaagaaacttcggtat
ctggaatgtgttattaaggagacccttcgcctttttccttctgttcctttatttgcccgt
agtgttagtgaagattgtgaagtggcaggttacagagttctaaaaggcactgaagccgtc
atcattccctatgcattgcacagagatccgagatacttccccaaccccgaggagttccag
cctgagcggttcttccccgagaatgcacaagggcgccatccatatgcctacgtgcccttc
tctgctggccccaggaactgtataggtcaaaagtttgctgtgatggaagaaaagaccatt
ctttcgtgcatcctgaggcacttttggatagaatccaaccagaaaagagaagagcttggt
ctagaaggacagttgattcttcgtccaagtaatggcatctggatcaagttgaagaggaga
aatgcagatgaacgctaa

DBGET integrated database retrieval system