KEGG   Homo sapiens (human): 285659Help
Entry
285659            CDS       T01001                                 

Gene name
OR2V2, OR2V3, OST713
Definition
olfactory receptor, family 2, subfamily V, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    285659 (OR2V2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    285659 (OR2V2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 315 aa AA seqDB search
METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPM
YFFLSQLSLMDLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMA
YDRYVAISHPLHYPILMNQRVCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFC
EMLSLLKLACVDTSLFEKVIFACCVFMLLFPFSIIVASYAHILGTVLQMHSAQAWKKALA
TCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYTVLTPMLNPLIYSLRNREVMG
ALRKGLDRCRIGSQH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtgggtgaaccagtcctacacagatggcttcttcctcttaggcatcttctcc
cacagtactgctgaccttgtcctcttctccgtggttatggcggtcttcacagtggccctc
tgtgggaatgtcctcctcatcttcctcatctacatggaccctcaccttcacacccccatg
tacttcttcctcagccagctctccctcatggacctcatgttggtctgtaccaatgtgcca
aagatggcagccaacttcctgtctggcaggaagtccatctcctttgtgggctgtggcata
caaattggcctctttgtctgtcttgtgggatctgaggggctcttgctgggactcatggct
tatgaccgctatgtggccattagccacccacttcactatcccatcctcatgaatcagagg
gtctgtctccagattactgggagctcctgggcctttgggataatcgatggcttgatccag
atggtggtagtaatgaatttcccctactgtggcttgaggaaggtgaaccatttcttctgt
gagatgctatccttgttgaagctggcctgtgtagacacatccctgtttgagaaggtgata
tttgcttgctgtgtcttcatgcttctcttcccattctccatcatcgtggcctcctatgct
cacattctagggactgtgctgcaaatgcactctgctcaggcctggaaaaaggccctggcc
acctgctcctcccacctgacagctgtcaccctcttctatggggcagccatgttcatctac
ctgaggcctaggcactaccgggcccccagccatgacaaggtggcctctatcttctacacg
gtccttactcccatgctcaaccccctcatttacagcttgaggaacagggaggtgatgggg
gcactgaggaaggggctggaccgctgcaggatcggcagccagcactga

DBGET integrated database retrieval system