KEGG   Homo sapiens (human): 285659Help
Entry
285659            CDS       T01001                                 

Gene name
OR2V2, OR2V3, OST713
Definition
(RefSeq) olfactory receptor family 2 subfamily V member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    285659 (OR2V2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    285659 (OR2V2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 285659
NCBI-ProteinID: NP_996763
HGNC: 15341
Ensembl: ENSG00000182613
Vega: OTTHUMG00000130933
Pharos: Q96R30(Tdark)
UniProt: Q96R30
Position
5q35.3
AA seq 315 aa AA seqDB search
METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPM
YFFLSQLSLMDLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMA
YDRYVAISHPLHYPILMNQRVCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFC
EMLSLLKLACVDTSLFEKVIFACCVFMLLFPFSIIVASYAHILGTVLQMHSAQAWKKALA
TCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYTVLTPMLNPLIYSLRNREVMG
ALRKGLDRCRIGSQH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtgggtgaaccagtcctacacagatggcttcttcctcttaggcatcttctcc
cacagtactgctgaccttgtcctcttctccgtggttatggcggtcttcacagtggccctc
tgtgggaatgtcctcctcatcttcctcatctacatggaccctcaccttcacacccccatg
tacttcttcctcagccagctctccctcatggacctcatgttggtctgtaccaatgtgcca
aagatggcagccaacttcctgtctggcaggaagtccatctcctttgtgggctgtggcata
caaattggcctctttgtctgtcttgtgggatctgaggggctcttgctgggactcatggct
tatgaccgctatgtggccattagccacccacttcactatcccatcctcatgaatcagagg
gtctgtctccagattactgggagctcctgggcctttgggataatcgatggcttgatccag
atggtggtagtaatgaatttcccctactgtggcttgaggaaggtgaaccatttcttctgt
gagatgctatccttgttgaagctggcctgtgtagacacatccctgtttgagaaggtgata
tttgcttgctgtgtcttcatgcttctcttcccattctccatcatcgtggcctcctatgct
cacattctagggactgtgctgcaaatgcactctgctcaggcctggaaaaaggccctggcc
acctgctcctcccacctgacagctgtcaccctcttctatggggcagccatgttcatctac
ctgaggcctaggcactaccgggcccccagccatgacaaggtggcctctatcttctacacg
gtccttactcccatgctcaaccccctcatttacagcttgaggaacagggaggtgatgggg
gcactgaggaaggggctggaccgctgcaggatcggcagccagcactga

DBGET integrated database retrieval system