KEGG   Homo sapiens (human): 2857Help
Entry
2857              CDS       T01001                                 

Gene name
GPR34, LYPSR1
Definition
(RefSeq) G protein-coupled receptor 34
  KO
K08383  
G protein-coupled receptor 34
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    2857 (GPR34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.4
AA seq 381 aa AA seqDB search
MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS
YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW
TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM
LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK
IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY
WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK
PGYSLHDTSVAVKIQSSSKST
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtcataccataacaatgacgacaacttcagtcagcagctggccttactcctcc
cacagaatgcgctttataaccaatcatagcgaccaaccgccacaaaacttctcagcaaca
ccaaatgttactacctgtcccatggatgaaaaattgctatctactgtgttaaccacatcc
tactctgttattttcatcgtgggactggttgggaacataatcgccctctatgtatttctg
ggtattcaccgtaaaagaaattccattcaaatttatctacttaacgtagccattgcagac
ctcctactcatcttctgcctccctttccgaataatgtatcatattaaccaaaacaagtgg
acactaggtgtgattctgtgcaaggttgtgggaacactgttttatatgaacatgtacatt
agcattattttgcttggattcatcagtttggatcgctatataaaaattaatcggtctata
cagcaacggaaggcaataacaaccaaacaaagtatttatgtctgttgtatagtatggatg
cttgctcttggtggattcctaactatgattattttaacacttaagaaaggagggcataat
tccacaatgtgtttccattacagagataagcataacgcaaaaggagaagccatttttaac
ttcattcttgtggtaatgttctggctaattttcttactaataatcctttcatatattaag
attgggaagaatctattgaggatttctaaaaggaggtcaaaatttcctaattctggtaaa
tatgccactacagctcgtaactcctttattgtacttatcatttttactatatgttttgtt
ccctatcatgcctttcgattcatctacatttcttcacagctaaatgtatcatcttgctac
tggaaagaaattgttcacaaaaccaatgagatcatgctggttctctcatctttcaatagt
tgcttagatccagtcatgtatttcctgatgtccagtaacattcgcaaaataatgtgccaa
cttctttttagacgatttcaaggtgaaccaagtaggagtgaaagcacttcagaatttaaa
ccaggatactccctgcatgatacatctgtggcagtgaaaatacagtctagttctaaaagt
acttga

DBGET integrated database retrieval system