KEGG   Homo sapiens (human): 285855Help
Entry
285855            CDS       T01001                                 

Gene name
RPL7L1, dJ475N16.4
Definition
(RefSeq) ribosomal protein L7 like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 255 aa AA seqDB search
MISSCTTRKMAEQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKR
LESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLR
LKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNT
VIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTP
GYRGERINQLIRQLN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtagctgcaccactagaaagatggcggagcaagagcaaagaaaaatccctttg
gttccagaaaatctcctgaaaaagaggaaggcttatcaagccctcaaagccacccaggca
aagcaggcacttttggcaaagaaggagcagaagaaaggaaaagggctcaggtttaagcga
ctggaatcattcctacatgattcctggcggcagaaacgtgacaaggtgcgtctcagacga
ctagaagtgaaacctcatgccttggaattgccagataaacattccttggcctttgttgta
cgcatcgaaaggattgacggcgtgagtttactggtgcagagaaccattgcaagacttcgc
ctaaagaaaatttttagtggtgtctttgtaaaagtcaccccccagaatctaaaaatgctg
cgtatagtggaaccttatgtgacctggggatttccaaatctgaagtctgtccgagaactc
attttgaaacgtggacaagccaaggtcaagaataagaccatccctctgacagacaataca
gtgattgaggagcacctggggaagtttggcgtcatttgcttggaagacctcattcatgaa
attgccttcccagggaagcatttccaggagatctcatggttcttgtgccctttccacctc
tcagtggcccgtcatgctaccaaaaatagagtgggcttcctcaaggagatgggcacacct
ggctatcggggtgaacgcatcaatcagctcatccgtcagctgaactag

DBGET integrated database retrieval system