KEGG   Homo sapiens (human): 2859Help
Entry
2859              CDS       T01001                                 

Gene name
GPR35
Definition
(RefSeq) G protein-coupled receptor 35
  KO
K04276  
G protein-coupled receptor 35
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2859 (GPR35)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    2859 (GPR35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.3
AA seq 309 aa AA seqDB search
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcacctacaacacctgtggctccagcgacctcacctggcccccagcgatcaag
ctgggcttctacgcctacttgggcgtcctgctggtgctaggcctgctgctcaacagcctg
gcgctctgggtgttctgctgccgcatgcagcagtggacggagacccgcatctacatgacc
aacctggcggtggccgacctctgcctgctgtgcaccttgcccttcgtgctgcactccctg
cgagacacctcagacacgccgctgtgccagctctcccagggcatctacctgaccaacagg
tacatgagcatcagcctggtcacggccatcgccgtggaccgctatgtggccgtgcggcac
ccgctgcgtgcccgcgggctgcggtcccccaggcaggctgcggccgtgtgcgcggtcctc
tgggtgctggtcatcggctccctggtggctcgctggctcctggggattcaggagggcggc
ttctgcttcaggagcacccggcacaatttcaactccatggcgttcccgctgctgggattc
tacctgcccctggccgtggtggtcttctgctccctgaaggtggtgactgccctggcccag
aggccacccaccgacgtggggcaggcagaggccacccgcaaggctgcccgcatggtctgg
gccaacctcctggtgttcgtggtctgcttcctgcccctgcacgtggggctgacagtgcgc
ctcgcagtgggctggaacgcctgtgccctcctggagacgatccgtcgcgccctgtacata
accagcaagctctcagatgccaactgctgcctggacgccatctgctactactacatggcc
aaggagttccaggaggcgtctgcactggccgtggctcccagtgctaaggcccacaaaagc
caggactctctgtgcgtgaccctcgcctaa

DBGET integrated database retrieval system