KEGG   Homo sapiens (human): 285971Help
Entry
285971            CDS       T01001                                 

Gene name
ZNF775
Definition
(RefSeq) zinc finger protein 775
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96BV0(Tdark)
UniProt: 
Position
7q36.1
AA seq 537 aa AA seqDB search
MESGLAGNGTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRP
RALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSGEGHFVCLDCGKRFSWWS
SLKIHQRTHTGEKPYLCGKCGKSFSQKPNLARHQRHHTGERPFCCPECARRFSQKQHLLK
HQKTHSRPATHSCPECERCFRHQVGLRIHQRAHARDRQGSRAGLHELIQDAAARRACRLQ
PGPPRGRPEWAWLGLCQGWWGQPGARAAVSGPEGPGEPRQFICNECGKSFTWWSSLNIHQ
RIHTGERPYACPECGRRFSQKPNLTRHLRNHTGERPHPCPHCGRGFRQKQHLLKHLRTHL
PGAQAAPCPSCGKSCRSRAALRAHQRAHAVAEPAVPAGEPGDQPQAEAIPGLAARPRSSQ
RSPGARDTLWGRGQAGLAGPGEPRQFICNECGKSFSWWSALTIHQRIHTGERPYPCPECG
RRFSQKPNLTRHRRNHTGERPYLCPACGRGFSQKQHLLKHQRVHRAAPACSPKEEAR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggcctggctggcaacggcacaggagctgggctggtgatgaaggtcaagcag
gagaagccggagcggctgctgcagacgctggcgccgcaggccatgcttgtggagaaggac
aaggagaacatatttcagcagcaccggggcctcccgccacgccagaccatggggcggcct
cgagccctggggggacaggaggagtctgggagtccaaggtgggcccctcccactgagcag
gatgcggggctggcaggccgggctcccgggtcagcctccggccccctgagcccctcgctt
tcctccggcgagggtcactttgtatgcctggactgcgggaagaggttcagctggtggtcg
tccctgaagatccaccagcgcacccacaccggggagaagccgtacctctgcggcaagtgc
ggcaagagcttcagccagaagccgaacctggcgcgccaccagcggcaccacacgggcgag
cgacccttctgctgccccgagtgcgcgcggcgcttcagccagaagcagcacctgctcaag
caccagaagacccactcccggcccgccacccactcgtgccccgagtgcgagcgctgcttc
cgtcaccaggtgggcctccgcatccaccagcgcgcgcacgcccgggaccgccagggctcc
cgcgccggcctgcacgagctgattcaggacgcggcggcgcgccgggcctgtcgcctgcag
ccggggccgccgcgggggcgccccgagtgggcctggctggggctctgccagggctggtgg
ggccagcccggggcccgggccgcggtctccggccccgaggggccgggcgagccgcgccag
ttcatctgcaacgagtgtggcaagagcttcacctggtggtcgtcgctgaacatccaccag
cgcatccacactggcgagcgcccctatgcgtgccccgagtgcggccgccgcttcagccag
aagcccaacttgacgcggcacctgcgcaaccacacaggcgagcgcccgcacccctgcccg
cactgtggccgcggcttccgccagaagcagcacctgctcaagcacctgcgcacgcacctg
cccggcgcccaggctgcgccctgccccagctgcggtaagagctgccgcagccgcgccgcg
ctgcgcgcccaccagcgcgcccacgctgtcgctgagcccgccgttccggccggggaaccg
ggcgaccagccgcaggccgaggccatcccgggcttggccgcgaggccgcggagctcccaa
cggtccccgggggcccgggacacgctgtggggccggggacaagcgggcctcgctgggcct
ggcgagccgcgccagttcatctgcaacgagtgcggcaagagcttctcgtggtggtcggcg
ctcaccatccaccagcgcatccacacgggtgagcggccctacccgtgccccgagtgcggc
cgccgcttcagccagaagcccaacctgacgcggcaccggcgcaaccacacaggcgagcgg
ccctacctgtgtcccgcctgcggccgcggcttcagccagaagcagcacctgctcaagcac
cagcgcgtgcaccgcgcggcccctgcgtgcagccccaaggaggaggcgcgctag

DBGET integrated database retrieval system