KEGG   Homo sapiens (human): 2863Help
Entry
2863              CDS       T01001                                 

Gene name
GPR39
Definition
(RefSeq) G protein-coupled receptor 39
  KO
K08412  
G protein-coupled receptor 39
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    2863 (GPR39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21-q22
AA seq 453 aa AA seqDB search
MASPSLPGSDCSQIIDHSHVPEFEVATWIKITLILVYLIIFVMGLLGNSATIRVTQVLQK
KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTSSYTLSCKLHTFLFEACSY
ATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPL
VNVPSHRGLTCNRSSTRHHEQPETSNMSICTNLSSRWTVFQSSIFGAFVVYLVVLLSVAF
MCWNMMQVLMKSQKGSLAGGTRPPQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQ
IRRIMAAAKPKHDWTRSYFRAYMILLPFSETFFYLSSVINPLLYTVSSQQFRRVFVQVLC
CRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQ
SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacccagcctcccgggcagtgactgctcccaaatcattgatcacagtcatgtc
cccgagtttgaggtggccacctggatcaaaatcacccttattctggtgtacctgatcatc
ttcgtgatgggccttctggggaacagcgccaccattcgggtcacccaggtgctgcagaag
aaaggatacttgcagaaggaggtgacagaccacatggtgagtttggcttgctcggacatc
ttggtgttcctcatcggcatgcccatggagttctacagcatcatctggaatcccctgacc
acgtccagctacaccctgtcctgcaagctgcacactttcctcttcgaggcctgcagctac
gctacgctgctgcacgtgctgacactcagctttgagcgctacatcgccatctgtcacccc
ttcaggtacaaggctgtgtcgggaccttgccaggtgaagctgctgattggcttcgtctgg
gtcacctccgccctggtggcactgcccttgctgtttgccatgggtactgagtaccccctg
gtgaacgtgcccagccaccggggtctcacttgcaaccgctccagcacccgccaccacgag
cagcccgagacctccaatatgtccatctgtaccaacctctccagccgctggaccgtgttc
cagtccagcatcttcggcgccttcgtggtctacctcgtggtcctgctctccgtagccttc
atgtgctggaacatgatgcaggtgctcatgaaaagccagaagggctcgctggccgggggc
acgcggcctccgcagctgaggaagtccgagagcgaagagagcaggaccgccaggaggcag
accatcatcttcctgaggctgattgttgtgacattggccgtatgctggatgcccaaccag
attcggaggatcatggctgcggccaaacccaagcacgactggacgaggtcctacttccgg
gcgtacatgatcctcctccccttctcggagacgtttttctacctcagctcggtcatcaac
ccgctcctgtacacggtgtcctcgcagcagtttcggcgggtgttcgtgcaggtgctgtgc
tgccgcctgtcgctgcagcacgccaaccacgagaagcgcctgcgcgtacatgcgcactcc
accaccgacagcgcccgctttgtgcagcgcccgttgctcttcgcgtcccggcgccagtcc
tctgcaaggagaactgagaagattttcttaagcacttttcagagcgaggccgagccccag
tctaagtcccagtcattgagtctcgagtcactagagcccaactcaggcgcgaaaccagcc
aattctgctgcagagaatggttttcaggagcatgaagtttga

DBGET integrated database retrieval system