KEGG   Homo sapiens (human): 286362Help
Entry
286362            CDS       T01001                                 

Gene name
OR13C9, OR37L, OR9-13
Definition
olfactory receptor, family 13, subfamily C, member 9
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    286362 (OR13C9)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    286362 (OR13C9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31.1
AA seq 318 aa AA seqDB search
MEWENQTILVEFFLKGHSVHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY
FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTTECVLLGMMAF
DRYVAICNPLRYPIIMSKNAYVPMAVGSWFAGIVNSAVQTTFVVQLPFCRKNVINHFSCE
ILAVMKLACADISGNEFLMLVATILFTLMPLLLIVISYSLIISSILKIHSSEGRSKAFST
CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN
KDVKEAVKHLPNRRFFSK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaaaaccaaaccattctggtggaattttttctgaagggacattctgttcac
ccaaggcttgagttactcttttttgtgctaatcttcataatgtatgtggtcatccttctg
gggaatggtactctcattttaatcagcatcttggaccctcaccttcacacccctatgtac
ttctttctggggaacctctccttcttggacatctgctacaccaccacctctattccctcc
acactagtgagcttcctttcagaaagaaagaccatttccttttctggctgtgcagtgcag
atgttccttggcttggccatggggacaacagagtgtgtgcttctgggcatgatggccttt
gaccgctatgtggctatctgcaaccctctgagatatcccatcatcatgagcaagaatgcc
tatgtacccatggctgttgggtcctggtttgcagggattgtcaactctgcagtacaaact
acatttgtagtacaattgcctttctgcaggaagaatgtcatcaatcatttctcatgtgaa
attctagctgtcatgaagttggcctgtgctgacatctcaggcaatgagttcctcatgctt
gtggccacaatattgttcacattgatgccactgctcttgatagttatctcttactcatta
atcatttccagcatcctcaagattcactcctctgaggggagaagcaaagctttctctacc
tgctcagcccatctgactgtggtcataatattctatgggaccatcctcttcatgtatatg
aagcccaagtctaaagagacacttaattcagatgacttggatgctaccgacaaaattata
tccatgttctatggggtgatgactcccatgatgaatcctttaatctacagtcttagaaac
aaggatgtgaaagaggcagtaaaacacctaccgaacagaaggttctttagcaagtga

DBGET integrated database retrieval system