KEGG   Homo sapiens (human): 2864Help
Entry
2864              CDS       T01001                                 

Gene name
FFAR1, FFA1R, GPCR40, GPR40
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  
free fatty acid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    2864 (FFAR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Free fatty acid
    2864 (FFAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
19q13.1
AA seq 300 aa AA seqDB search
MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccccgcagctctccttcggcctctatgtggccgcctttgcgctgggcttc
ccgctcaacgtcctggccatccgaggcgcgacggcccacgcccggctccgtctcacccct
agcctggtctacgccctgaacctgggctgctccgacctgctgctgacagtctctctgccc
ctgaaggcggtggaggcgctagcctccggggcctggcctctgccggcctcgctgtgcccc
gtcttcgcggtggcccacttcttcccactctatgccggcgggggcttcctggccgccctg
agtgcaggccgctacctgggagcagccttccccttgggctaccaagccttccggaggccg
tgctattcctggggggtgtgcgcggccatctgggccctcgtcctgtgtcacctgggtctg
gtctttgggttggaggctccaggaggctggctggaccacagcaacacctccctgggcatc
aacacaccggtcaacggctctccggtctgcctggaggcctgggacccggcctctgccggc
ccggcccgcttcagcctctctctcctgctcttttttctgcccttggccatcacagccttc
tgctacgtgggctgcctccgggcactggcccgctccggcctgacgcacaggcggaagctg
cgggccgcctgggtggccggcggggccctcctcacgctgctgctctgcgtaggaccctac
aacgcctccaacgtggccagcttcctgtaccccaatctaggaggctcctggcggaagctg
gggctcatcacgggtgcctggagtgtggtgcttaatccgctggtgaccggttacttggga
aggggtcctggcctgaagacagtgtgtgcggcaagaacgcaagggggcaagtcccagaag
taa

DBGET integrated database retrieval system