KEGG   Homo sapiens (human): 286436Help
Entry
286436            CDS       T01001                                 

Gene name
H2BFM
Definition
H2B histone family, member M
Orthology
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Position
Xq22.2
AA seq 154 aa AA seqDB search
MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSF
TPYFPRVLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMA
VRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcttccgccatggctgaggcttcctctgagacaacctcggaggaaggccag
agcatccaggagcccaaagaggccaactccacgaaggcccagaagcagaagaggcgaggg
tgccgaggctcccgcaggcgccacgccaaccgccgtggggacagcttcggggacagcttc
accccctatttcccccgggtgctgaagcaggttcaccagggcctcagcctttcccaggag
gccgtgagtgtcatggattctatgatccatgacatattggaccgcatcgccaccgaggct
ggtcagctggcccattacaccaagcgcgtgaccatcacctcccgggacatccagatggcc
gtgcgactgctgctgccggggaagatgggcaagctcgccgaggcccagggcacgaatgcc
gccctcagaacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system