KEGG   Homo sapiens (human): 286436Help
Entry
286436            CDS       T01001                                 

Gene name
H2BFM
Definition
H2B histone family, member M
Orthology
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    286436 (H2BFM)
  Immune diseases
   05322 Systemic lupus erythematosus
    286436 (H2BFM)
  Substance dependence
   05034 Alcoholism
    286436 (H2BFM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   286436 (H2BFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.2
AA seq 154 aa AA seqDB search
MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSF
TPYFPRVLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMA
VRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcttccgccatggctgaggcttcctctgagacaacctcggaggaaggccag
agcatccaggagcccaaagaggccaactccacgaaggcccagaagcagaagaggcgaggg
tgccgaggctcccgcaggcgccacgccaaccgccgtggggacagcttcggggacagcttc
accccctatttcccccgggtgctgaagcaggttcaccagggcctcagcctttcccaggag
gccgtgagtgtcatggattctatgatccatgacatattggaccgcatcgccaccgaggct
ggtcagctggcccattacaccaagcgcgtgaccatcacctcccgggacatccagatggcc
gtgcgactgctgctgccggggaagatgggcaagctcgccgaggcccagggcacgaatgcc
gccctcagaacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system