KEGG   Homo sapiens (human): 286530Help
Entry
286530            CDS       T01001                                 

Gene name
P2RY8, P2Y8
Definition
(RefSeq) purinergic receptor P2Y8
  KO
K08386  
purinergic receptor P2Y, G protein-coupled, 8
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    286530 (P2RY8)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    286530 (P2RY8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.33; Yp11.3
AA seq 359 aa AA seqDB search
MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVI
FMINLSVTDLMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVE
RFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLK
WTMLPSVAMWAVFLFTIFILLFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAA
VVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREF
QLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcccgaacagcaccggcccggacaacgcgacgctgcagatgctgcggaacccg
gcgatcgcggtggccctgcccgtggtgtactcgctggtggcggcggtcagcatcccgggc
aacctcttctctctgtgggtgctgtgccggcgcatggggcccagatccccgtcggtcatc
ttcatgatcaacctgagcgtcacggacctgatgctggccagcgtgttgcctttccaaatc
tactaccattgcaaccgccaccactgggtattcggggtgctgctttgcaacgtggtgacc
gtggccttttacgcaaacatgtattccagcatcctcaccatgacctgtatcagcgtggag
cgcttcctgggggtcctgtacccgctcagctccaagcgctggcgccgccgtcgttacgcg
gtggccgcgtgtgcagggacctggctgctgctcctgaccgccctgtccccgctggcgcgc
accgatctcacctacccggtgcacgccctgggcatcatcacctgcttcgacgtcctcaag
tggacgatgctccccagcgtggccatgtgggccgtgttcctcttcaccatcttcatcctg
ctgttcctcatcccgttcgtgatcaccgtggcttgttacacggccaccatcctcaagctg
ttgcgcacggaggaggcgcacggccgggagcagcggaggcgcgcggtgggcctggccgcg
gtggtcttgctggcctttgtcacctgcttcgcccccaacaacttcgtgctcctggcgcac
atcgtgagccgcctgttctacggcaagagctactaccacgtgtacaagctcacgctgtgt
ctcagctgcctcaacaactgtctggacccgtttgtttattactttgcgtcccgggaattc
cagctgcgcctgcgggaatatttgggctgccgccgggtgcccagagacaccctggacacg
cgccgcgagagcctcttctccgccaggaccacgtccgtgcgctccgaggccggtgcgcac
cctgaagggatggagggagccaccaggcccggcctccagaggcaggagagtgtgttctga

DBGET integrated database retrieval system