KEGG   Homo sapiens (human): 287Help
Entry
287               CDS       T01001                                 

Gene name
ANK2, ANK-2, LQT4, brank-2
Definition
(RefSeq) ankyrin 2, neuronal
  KO
K10380  
ankyrin
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
Disease
H00720  
Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    287 (ANK2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    287 (ANK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q25-q27
AA seq 3957 aa AA seqDB search
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL
VHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLAS
PDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLE
KVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVR
IDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGK
DIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGED
PGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKK
TTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPS
AKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSG
RTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSK
TERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQR
EAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVP
EEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETE
KAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLME
GTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHP
TTKDITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETP
TGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQ
GVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPL
KESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDD
SLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKK
RFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHT
GSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMD
SNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYD
KLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEK
DTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTD
ETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSE
ESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQE
STLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVK
EEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMT
KRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEAD
LLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVK
QISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTES
KSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQ
LSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRER
AEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEE
ISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWD
ESIETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQ
IRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERI
SHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVG
YSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTE
TSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESS
PRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVT
RKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGYSKVIKRVVLKSDTEQSEDNNE
NT seq 11874 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgaagatgcagctcagaaaagcgacagtggagagaagttcaacggcagtagt
cagaggagaaaaagacccaagaagtctgacagcaatgcaagcttcctccgtgctgccaga
gcaggcaacctggacaaagttgtggaatatctgaaggggggcatagacatcaatacctgc
aatcagaatggactcaacgctctccatctggctgccaaggaaggccacgtggggctggtg
caggagctgctgggaagagggtcctctgtggattctgccactaagaagggaaataccgct
cttcacattgcatctttggctggacaagcagaagttgtcaaagttcttgttaaggaagga
gccaatattaatgcacagtctcagaatggctttactcctttatacatggctgcccaagag
aatcacattgatgttgtaaaatatttgctggaaaatggagctaatcagagcactgctaca
gaggatggctttactcctctagctgtggcactccagcaaggacacaaccaggcggtggcc
atcctcttggagaatgacaccaaagggaaagtgaggctgccagctctgcatattgccgct
aggaaagacgacaccaaatctgccgcacttctgcttcagaatgaccacaatgctgacgta
caatccaagatgatggtgaataggacaactgagagtggttttacccctttgcacatagct
gcacattacggaaatgtcaacgtggcaactcttcttctaaaccggggagctgctgtggac
ttcacagccaggaatggaatcactcctctgcatgtggcttccaaaagaggaaatacaaac
atggtgaagctcttactggatcgaggcggtcagatcgatgccaaaactagggatgggttg
acaccacttcactgtgctgcacgaagtgggcatgaccaagtggtggaacttctgttggaa
cggggtgcccccttgctggcaaggactaagaatgggctgtctccactacacatggctgcc
cagggagaccacgtggaatgtgtgaagcacctgttacagcacaaggcacctgttgatgat
gtcaccctagactacctgacagccctccacgttgctgcgcactgtggccactaccgtgta
accaaactccttttagacaagagagccaatccgaacgccagagccctgaatggttttact
ccactgcacattgcctgcaagaaaaaccgcatcaaagtcatggaactgctggtgaaatat
ggggcttcaatccaagctataacagagtctggcctcacaccaatacatgtggctgccttc
atgggccacttgaacattgtcctccttctgctgcagaacggagcctctccagatgtcact
aacattcgtggtgagacggcactacacatggcagcccgagccgggcaggtggaagtggtc
cgatgcctcctgagaaatggtgcccttgttgatgccagagccagggaggaacagacacct
ttacatattgcctcccgcctgggtaagacagaaattgtccagctgcttctacaacatatg
gctcatccagatgcggccactacaaatgggtacacaccactgcacatctctgcccgggag
ggccaggtggatgtggcatcagtcctattggaagcaggagcagcccactccttagctacc
aagaagggttttactcccctgcatgtagcagccaagtatggaagcctggatgtggcaaaa
cttctcttgcaacgccgtgctgccgcagattctgcagggaagaacggccttaccccgctc
catgttgctgctcattatgacaaccagaaggtggcgctgctgttactggagaagggtgct
tcccctcatgccactgccaagaatggctatactccgttacatattgctgccaagaagaat
caaatgcagatagcttccacactcctgaactatggagcagagacaaacattgtgacaaag
caaggagtaactccactccatctggcctcgcaggaggggcacacagatatggttaccttg
cttctggataagggagccaatatccacatgtcaactaagagtggactcacatccttacac
cttgcagcccaggaagataaagtgaatgttgctgatattctcaccaagcatggagctgat
caggatgctcatacaaagcttggttacacacctttaattgtggcctgtcactatggaaat
gtgaaaatggtcaactttcttctgaagcagggagcaaatgttaacgcaaaaaccaagaac
ggctacacgcctttgcaccaggccgctcagcagggtcacacgcacatcatcaacgtcctg
ctccagcatggggccaagcccaacgccaccactgcgaatggcaacactgccttggcgatt
gctaagcgtctgggctacatctccgtggtcgacaccctgaaggttgtgactgaggaggtc
accaccaccaccacaactattacagaaaaacacaaactaaatgtacctgagacgatgact
gaggttcttgatgtttctgatgaagagggtgatgacacaatgactggtgatgggggagaa
taccttaggcctgaggacctaaaagaactgggtgatgactcactacccagcagtcagttc
ctggatggtatgaattacctgcgatacagcttggagggaggacgatctgacagccttcga
tccttcagttccgacaggtctcacactctgagccatgcctcctacctgagggacagtgcc
gtgatggatgactcagttgtgattcccagtcaccaggtgtcaactctagccaaggaggca
gaaaggaattcttatcgcctaagctggggcactgagaacttagacaacgtggctctttct
tctagtcctattcattcaggtttcctggttagttttatggtggatgcccgaggtggtgct
atgcgaggatgcagacacaatgggctccgaatcattattccacctcggaaatgtactgct
ccaacgcgagtcacctgccgactggtcaagcgccacagactggcaacaatgcctccaatg
gtggaaggagaaggcctggccagtcgcctgatcgaagttggaccttctggtgctcagttc
cttggtaaacttcacctgccaacggctcctcccccacttaatgagggagaaagtttggtc
agccgcattcttcagctggggcctcctggaaccaaattccttgggcctgtgatcgtggag
atccctcactttgcggcccttcgaggaaaggaaagggaactggtggtcctgcgcagtgag
aatggggacagctggaaagagcatttctgtgactacactgaagatgaattgaatgaaatt
cttaacggcatggatgaagtactggatagcccagaagacctagaaaagaaacgaatctgc
cgcatcatcacccgagacttcccacagtactttgcagtggtgtctcgtatcaaacaggac
agcaatctgattggcccagaaggaggtgtactgagcagcacagtggtgccccaggtgcag
gccgtcttcccagagggggcactcaccaagcggatccgcgtaggcctgcaggctcaacct
atgcacagtgagctggttaagaagatcctaggcaacaaagctaccttcagccctatagtc
actttggaacctagaagaagaaaattccacaaaccaattaccatgaccattcctgtcccc
aaagcttcaagtgatgtcatgttgaatggttttgggggagatgcaccaaccttaagatta
ctatgcagcataacaggtggaaccacccctgcccagtgggaagatattacaggaactacg
ccattaacatttgtcaatgaatgtgtttcctttacaacaaacgtgtctgccaggttctgg
ctgatagattgtcgacagatccaggaatccgttacttttgcatcacaagtatacagagaa
attatctgcgtaccttatatggccaaatttgtagtgtttgccaaatcacatgaccccatt
gaagccaggttgaggtgtttctgcatgactgatgataaagtggataagacccttgaacaa
caagaaaattttgctgaggtggccagaagcagggatgtggaggtgttagaaggaaaaccc
atctacgttgattgtttcggcaacttggtaccattaactaaaagtggccagcatcatata
ttcagtttttttgccttcaaagaaaatagacttcctctatttgtcaaggtacgcgatacg
actcaggaaccttgcggacgactatcatttatgaaggagccaaaatccacgagaggcctg
gtgcatcaagctatttgcaacttaaacatcactttgccgatttatacaaaggaatcagag
tcagatcaagaacaggaggaagagatcgatatgacatcagaaaaaaatgatgagacagaa
tctacagaaacatctgtcctgaaaagtcacctggttaatgaagttcctgtcctagcaagt
ccggacttgctctctgaagtttctgagatgaaacaagatttgatcaaaatgaccgccatc
ttgaccacagatgtgtctgataaggcaggttctattaaagtgaaggagctggtgaaggct
gctgaggaagagccaggagagccttttgaaatcgttgaaagagttaaagaggacttagag
aaagtgaatgaaatcctgagaagtggaacctgcacaagagatgaaagcagtgtgcagagc
tctcggtctgagagaggattagttgaagaggaatgggttattgtcagtgatgaggaaata
gaagaggctaggcaaaaagcacctttagaaatcactgaatatccatgtgtagaagttaga
atagataaagagatcaaaggaaaagtagagaaagactcaactgggctagtgaactacctt
actgatgatctgaatacctgtgtgcctcttcccaaagagcagctgcagacagttcaagat
aaggcagggaagaaatgtgaggctctggctgttggcaggagctctgaaaaggaagggaaa
gacatacccccagatgagacacagagtacacagaaacagcacaaaccaagcttgggaata
aagaagccagtaagaaggaaattaaaagaaaagcagaaacaaaaagaggaaggtttacaa
gctagtgcagagaaagctgaacttaaaaaaggtagttcagaagagtcattaggtgaagac
ccaggtttagcccctgaaccccttcccactgtcaaggccacatctcctttgatagaagaa
actcccattggttccataaaggacaaagtaaaggcccttcagaagcgagtggaagatgaa
cagaaaggtcgaagcaagttgcccatcagagtcaaaggcaaggaggacgtgccaaaaaag
accacccacaggccacatccagctgcgtcaccctctctgaagtcagagagacatgcgcca
gggtctccctcccctaaaacagaaagacactctactctttcctcttccgcaaaaactgaa
aggcaccctccagtatcaccatcaagtaaaactgagaaacactcacctgtgtcaccctct
gcaaaaacggaaagacattcacctgcgtcatcatcgagtaaaactgagaaacactcacct
gtatcaccctcgacaaaaactgaaaggcactctcctgtgtcatctacaaaaacagaaaga
cacccacctgtttcgccttcaggcaaaacagacaaacgtccacctgtatcgccctccggg
aggacagaaaaacacccgccagtatcgcctgggagaacagaaaaacgcttgcctgtttca
ccctccggaagaacggacaagcaccaacctgtatcaacagctgggaaaactgagaagcac
ctgcctgtgtcaccttctggcaaaacagaaaagcaaccacctgtatcccccacttcaaaa
acagagaggattgaggaaaccatgtctgttcgggagctgatgaaggctttccagtcaggt
caggacccttctaaacataaaactggactctttgagcacaaatcagcaaaacaaaagcag
ccacaagagaaaggtaaagttcgggtagaaaaagaaaaggggccgatactaacccagaga
gaagctcagaaaacagagaatcagacaatcaaacgaggccagagactcccggtaacgggc
acagcagaatccaaaagaggagttcgtgtttcctccataggagttaagaaagaagatgca
gctggaggaaaggagaaagttctcagccacaaaatacctgaacctgttcagtcagtgcct
gaagaagaaagccacagagagagcgaagtgcccaaagaaaagatggctgatgagcaggga
gacatggatctacagatcagcccagataggaaaacctccactgacttctctgaggtcatt
aagcaagagttggaagacaatgacaaataccaacaattccgcctgagtgaggagacagaa
aaggcacagcttcacttagaccaagtactcactagtcctttcaacacaacatttccactc
gactacatgaaagatgagttccttccagctctgtctttacaaagcggtgctttagatggc
agttctgaaagcctaaagaatgagggggtagccggctctccgtgtggcagcctgatggag
gggacccctcagattagttcagaagaaagctataagcatgaaggcctagcagagacccct
gagacgagcccagaaagcctttctttctcaccaaagaaaagtgaggagcaaactggggaa
acaaaggaaagcaccaagacagaaaccaccacagaaattcgttcagaaaaagagcatccc
acgaccaaagacattactggtggctctgaagagcgaggtgccacagtcactgaggactca
gagacctctactgagagttttcagaaagaggccactctaggctctcccaaagacacaagc
cctaaaagacaagatgattgcacaggcagctgtagtgtagcattagctaaagagacacct
acaggactgactgaggaggcagcctgtgatgaaggtcaacgtacctttggtagttcagcc
cacaagacacaaactgatagtgaggttcaagaatccacagccacctcagacgagacaaag
gccttgccgctgcctgaggcttctgtaaagacagatacaggaactgaatcaaaacctcag
ggagtcattagaagtccccaagggttagaacttgcactccctagccgagatagcgaagtc
ctcagcgctgtggctgatgactcattagcagtgagccacaaagactctctggaagccagc
cctgtgctagaagataactcttcacacaaaacccctgattctctggagccaagtcctctg
aaagaatccccttgccgtgactctctggaaagcagccctgttgaaccaaagatgaaggct
ggaatttttccaagtcactttcctcttcctgcagctgttgccaaaacagaactcttgacg
gaagtggcctctgtgcggtcccggctactccgagaccctgatggcagtgctgaggatgac
agtcttgagcagacatcgctcatggagagctcagggaagagccccctttctcctgacacc
cccagctctgaagaagtcagctatgaggttacacccaaaaccacagatgtaagtacacca
aaaccagctgtgattcatgaatgtgcagaggaggatgattcagaaaacggggagaaaaag
aggttcacacctgaagaggagatgtttaaaatggtaaccaaaatcaaaatgtttgatgaa
cttgaacaagaagcaaagcagaaaagggactacaaaaaagaacccaaacaagaagaatct
tcttcatcttctgacccagatgctgactgttcagtagatgtggatgaaccaaaacataca
ggcagtggggaggatgaaagtggtgtccctgtgttagtaacttcggagagcaggaaggtg
tcttcctcctcagaaagtgaacctgagttggcacagcttaaaaaaggtgctgactcaggc
cttttaccagaaccagtgattcgagtacaacctccttctccacttccatcaagcatggac
tccaattccagtccagaagaagtacaattccagcctgtcgtttccaaacaatatactttc
aagatgaatgaagatactcaggaagagccaggcaaatcagaagaagaaaaagattctgaa
tcccatttagctgaagaccgtcatgctgtttccactgaggctgaagacaggtcttatgat
aagctaaacagagacactgatcagccaaaaatctgtgatggccatggatgtgaggccatg
agtcctagcagctcagctgctcctgtctcttcaggtctacagagtccgactggtgatgat
gttgatgaacagccagtcatctataaagaatcattagctctccaaggcactcatgaaaaa
gacacagagggagaagagcttgatgtttctagagcagaatctccacaagcagattgcccc
agtgaaagcttttcatcttcatcctctttgcctcattgtttggtatctgaaggaaaagaa
ttagatgaagacatatctgccacatcttctattcaaaaaacagaggtcacaaaaactgat
gaaacatttgagaacttaccaaaggactgcccctctcaagactcatccattactactcaa
acagatagattttccatggatgttcccgtgtctgacctagctgagaatgatgaaatctat
gatccacaaatcactagcccttatgaaaatgtcccttcccaatcttttttctctagtgaa
gaaagcaaaacccaaacagatgcaaatcacaccacaagttttcactcttctgaagtgtat
tctgttaccatcacatcccctgttgaagacgttgtagtggcaagctcctctagtggaact
gttttaagcaaagaatctaattttgagggccaggacataaaaatggaatcccaacaggaa
agtaccttgtgggaaatgcaatcagacagtgtctcttcatctttcgagcctactatgtcc
gctacaacaacagttgttggtgaacaaataagcaaagtcatcatcacaaaaactgatgtg
gattctgattcttggagtgaaattcgggaagacgatgaagcctttgaggctcgtgtgaaa
gaggaagaacaaaagatatttggtttgatggtagacagacaatcacagggtaccacccct
gacaccactcctgctaggaccccaactgaagaggggaccccaacaagtgagcaaaaccca
tttctgtttcaggaaggaaaattgtttgaaatgacccgaagtggtgccattgatatgacc
aaaaggtcctatgcagatgaaagttttcactttttccaaattggtcaagaatccagggaa
gagactctctctgaagatgtgaaagaaggggctactggggctgatcccctaccgctggag
acatcagctgaatcactagcactttcagaatcaaaagaaacagtggatgatgaggcagac
ttacttccagatgacgtgagtgaggaagtagaggaaatacctgcttcggatgctcaactt
aactcccaaatggggatttcagcctccactgaaacacctacaaaagaagctgttagtgta
gggaccaaggacctccccaccgtgcaaacgggtgatatacctcctctctctggtgtaaag
cagatatcctgccccgactcttctgaaccagctgtacaagtccagttagatttttccaca
ctcaccaggtctgtttattcagataggggtgatgattctcccgattcttccccagaagaa
cagaaatcagtaatcgagattcctactgcacccatggagaatgtgccttttactgaaagc
aaatccaaaattcctgtaaggactatgcccacttccaccccagcacctccatctgcagag
tatgagagttcagtttctgaagattttctatccagtgtagatgaggaaaataaggcggat
gaagcaaaaccaaagtccaaactccctgtcaaagtacccctccaaagagttgaacagcag
ctctcagatctagacacctctgtccagaagacagtggctcctcagggacaggacatggca
agcatcgcaccagataatagaagcaaatctgaatctgatgctagttctttggattcaaag
accaaatgcccagtaaaaacccgaagttacactgagacagaaacagagagcagagagagg
gccgaggaacttgagttagaatcagaagaaggggccacaagaccaaagatacttacatcc
cgattgccagttaagagcagaagcactacatcttcctgcagggggggcacgagccccaca
aaagaaagtaaggagcatttctttgacctttacagaaattccatagaattctttgaggag
attagtgatgaggcttccaaattagtggataggctgacacagtcagagagggagcaggaa
atagtttcagacgatgaaagtagtagtgccctggaagtatcagtaattgaaaatctgcca
cctgttgagaccgagcactcagttcctgaggacatctttgacacaaggcccatttgggat
gagtctattgagactctgattgaacgcatccctgatgaaaatggccatgaccatgctgaa
gatccacaggatgagcaggaacggatcgaggaaaggctggcttatattgctgatcacctt
ggcttcagctggacagaattagcaagagaactggatttcactgaggagcaaattcatcaa
attcgaattgaaaatcccaactctcttcaagaccagagtcatgcactgttgaagtactgg
ctagagagggatgggaaacatgctacagataccaacctcgttgaatgtctcaccaagatc
aaccgaatggatattgttcatctcatggagaccaacacagaacctctccaggagcgcatc
agtcatagttatgcagaaattgaacagaccattacactggatcatagtgaagggttctcg
gtacttcaagaggagttatgcactgcacagcacaagcagaaagaggagcaagctgtttct
aaagaaagtgagacctgcgatcaccctcctatcgtctcagaggaagacatttctgttggt
tattccacttttcaggatggcgtccccaaaactgagggggacagctcagcaacagcactc
tttccccaaactcacaaggagcaagttcaacaggatttctcagggaaaatgcaagacctg
cctgaagagtcatctctggaatatcagcaggaatattttgtgacaactccaggaacagaa
acatcagagactcagaaggctatgatagtacccagctctcccagcaagacacctgaggaa
gttagcacccctgcagaggaggagaagctgtacctccagaccccaacatccagcgagcgg
ggaggctctcccatcatacaagaacccgaagagccctcagagcacagagaggagagctct
ccgcggaaaaccagcctcgtaatagtggagtctgccgataaccagcctgagacctgtgaa
agactcgatgaagatgcagcttttgaaaagggagacgatatgcctgaaatacccccagaa
acagtcacagaagaagaatacattgatgagcatggacacaccgtggtaaagaaggttact
aggaaaatcattaggcggtatgtatcctctgaaggcacagagaaagaagagattatggtg
cagggaatgccacaggaacctgtcaacatcgaggaaggggatggctattccaaagttata
aagcgtgttgtattgaagagtgacaccgagcagtcagaggacaacaatgagtaa

DBGET integrated database retrieval system