KEGG   Homo sapiens (human): 2872Help
Entry
2872              CDS       T01001                                 

Gene name
MKNK2, GPRK7, MNK2
Definition
(RefSeq) MAP kinase interacting serine/threonine kinase 2
  KO
K04372  MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2872 (MKNK2)
   04066 HIF-1 signaling pathway
    2872 (MKNK2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2872 (MKNK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2872 (MKNK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   2872 (MKNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo zf-RRN7 ABC_trans_aux APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2872
NCBI-ProteinID: NP_951009
OMIM: 605069
HGNC: 7111
Ensembl: ENSG00000099875
Vega: OTTHUMG00000180020
Pharos: Q9HBH9(Tchem)
UniProt: Q9HBH9 B3KS07
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 465 aa AA seqDB search
MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAK
KRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaagaaaccagccgaacttcagggtttccaccgttcgttcaaggggcagaac
cccttcgagctggccttctccctagaccagcccgaccacggagactctgactttggcctg
cagtgctcagcccgccctgacatgcccgccagccagcccattgacatcccggacgccaag
aagaggggcaagaagaagaagcgcggccgggccaccgacagcttctcgggcaggtttgaa
gacgtctaccagctgcaggaagatgtgctgggggagggcgctcatgcccgagtgcagacc
tgcatcaacctgatcaccagccaggagtacgccgtcaagatcattgagaagcagccaggc
cacattcggagcagggttttcagggaggtggagatgctgtaccagtgccagggacacagg
aacgtcctagagctgattgagttcttcgaggaggaggaccgcttctacctggtgtttgag
aagatgcggggaggctccatcctgagccacatccacaagcgccggcacttcaacgagctg
gaggccagcgtggtggtgcaggacgtggccagcgccttggactttctgcataacaaaggc
atcgcccacagggacctaaagccggaaaacatcctctgtgagcaccccaaccaggtctcc
cccgtgaagatctgtgacttcgacctgggcagcggcatcaaactcaacggggactgctcc
cctatctccaccccggagctgctcactccgtgcggctcggcggagtacatggccccggag
gtagtggaggccttcagcgaggaggctagcatctacgacaagcgctgcgacctgtggagc
ctgggcgtcatcttgtatatcctactcagcggctacccgcccttcgtgggccgctgtggc
agcgactgcggctgggaccgcggcgaggcctgccctgcctgccagaacatgctgtttgag
agcatccaggagggcaagtacgagttccccgacaaggactgggcccacatctcctgcgct
gccaaagacctcatctccaagctgctggtccgtgacgccaagcagaggctgagtgccgcc
caagtcctgcagcacccctgggttcaggggtgcgccccggagaacaccttgcccactccc
atggtcctgcagaggaacagctgtgccaaagacctcacgtccttcgcggctgaggccatt
gccatgaaccggcagctggcccagcacgacgaggacctggctgaggaggaggccgcgggg
cagggccagcccgtcctggtccgagctacctcacgctgcctgcagctgtctccaccctcc
cagtccaagctggcgcagcggcggcaaagggccagtctgtcctcggccccagtggtcctg
gtgggagaccacgcctga

KEGG   Homo sapiens (human): 8569Help
Entry
8569              CDS       T01001                                 

Gene name
MKNK1, MNK1
Definition
(RefSeq) MAP kinase interacting serine/threonine kinase 1
  KO
K04372  MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8569 (MKNK1)
   04066 HIF-1 signaling pathway
    8569 (MKNK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    8569 (MKNK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8569 (MKNK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   8569 (MKNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH zf-RRN7
Motif
Other DBs
NCBI-GeneID: 8569
NCBI-ProteinID: NP_003675
OMIM: 606724
HGNC: 7110
Ensembl: ENSG00000079277
Vega: OTTHUMG00000007983
Pharos: Q9BUB5(Tchem)
UniProt: Q9BUB5
Structure
PDB: 

Jmol
Position
1p33
AA seq 465 aa AA seqDB search
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtatcttctcaaaagttggaaaaacctatagagatgggcagtagcgaaccccttccc
atcgcagatggtgacaggaggaggaagaagaagcggaggggccgggccactgactccttg
ccaggaaagtttgaagatatgtacaagctgacctctgaattgcttggagagggagcctat
gccaaagttcaaggtgccgtgagcctacagaatggcaaagagtatgccgtcaaaatcatc
gagaaacaagcagggcacagtcggagtagggtgtttcgagaggtggagacgctgtatcag
tgtcagggaaacaagaacattttggagctgattgagttctttgaagatgacacaaggttt
tacttggtctttgagaaattgcaaggaggttccatcttagcccacatccagaagcaaaag
cacttcaatgagcgagaagccagccgagtggtgcgggacgttgctgctgcccttgacttc
ctgcataccaaagacaaagtctctctctgtcacctaggctggagtgctatggcgccatca
gggctcactgcagccccaacctccctgggctccagtgatcctcccacctcagcctcccaa
gtagctgggactacaggcattgctcatcgtgatctgaaaccagaaaatatattgtgtgaa
tctccagaaaaggtgtctccagtgaaaatctgtgactttgacttgggcagtgggatgaaa
ctgaacaactcctgtacccccataaccacaccagagctgaccaccccatgtggctctgca
gaatacatggcccctgaggtagtggaggtcttcacggaccaggccacattctacgacaag
cgctgtgacctgtggagcctgggcgtggtcctctacatcatgctgagtggctacccaccc
ttcgtgggtcactgcggggccgactgtggctgggaccggggcgaggtctgcagggtgtgc
cagaacaagctgtttgaaagcatccaggaaggcaagtatgagtttcctgacaaggactgg
gcacacatctccagtgaagccaaagacctcatctccaagctcctggtgcgagatgcaaag
cagagacttagcgccgcccaagttctgcagcacccatgggtgcaggggcaagctccagaa
aagggactccccacgccgcaagtcctccagaggaacagcagcacaatggacctgacgctc
ttcgcagctgaggccatcgcccttaaccgccagctatctcagcacgaagagaacgaacta
gcagaggagccagaggcactagctgatggcctctgctccatgaagctttcccctccctgc
aagtcacgcctggcccggagacgggccctggcccaggcaggccgtggtgaagacaggagc
ccgcccacagcactctga

DBGET integrated database retrieval system