KEGG   Homo sapiens (human): 2874Help
Entry
2874              CDS       T01001                                 

Gene name
GPS2, AMF-1
Definition
G protein pathway suppressor 2
Orthology
K15307  
G protein pathway suppressor 2
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    2874 (GPS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13
AA seq 327 aa AA seqDB search
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERM
SLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSL
TVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQF
QGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQ
TGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGK
SGFAATSQPGPRLPFIQHSQNPRFYHK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcactcctggagcgccccaagctttccaacgccatggccagggcgctgcaccgg
cacattatgatggagcgggagcgcaagcggcaggaggaagaagaggtggataagatgatg
gaacagaagatgaaggaagaacaggagagaaggaagaaaaaggagatggaagagagaatg
tcattagaggagaccaaggaacaaattctgaagttggaggagaagcttttggctctacag
gaagagaagcaccagcttttcctgcagctcaagaaagttttacatgaggaagaaaaacgg
aggcgaaaggaacagagtgacctgaccaccctaacatcagctgcataccagcagagcctg
actgttcacacaggaactcatctcctcagcatgcaggggagccctggaggacacaatcgc
ccaggcaccctcatggcagctgacagagccaaacaaatgtttggaccccaagtgcttacg
acccggcactacgtgggctcagcagctgcttttgcagggacaccagagcatggacaattc
caaggcagtcctggtggtgcctatgggactgctcagcccccacctcactatgggcccaca
cagccagcttatagtcctagtcagcagctcagagctccttcggcattccctgcagtgcag
tacctatctcagccacagccacagccctatgctgtgcatggccactttcagcccactcag
acaggtttcctccagcctggtggtgccctgtccttgcaaaagcagatggaacatgctaac
cagcagactggcttctccgactcatcctctctgcgccccatgcacccccaggctctgcat
ccagcccctggactccttgcttccccccagctccctgtgcagatgcagccagcaggaaag
tcgggctttgcagctaccagccaacctggccctcggctccccttcatccaacacagccag
aacccgcgattctaccacaagtga

DBGET integrated database retrieval system