KEGG   Homo sapiens (human): 2875Help
Entry
2875              CDS       T01001                                 

Gene name
GPT, AAT1, ALT1, GPT1
Definition
glutamic-pyruvate transaminase (alanine aminotransferase) (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hsa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hsa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 496 aa AA seqDB search
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgagcacaggtgaccggagccaggcggtgaggcatggactgagggcgaaggtg
ctgacgctggacggcatgaacccgcgtgtgcggagagtggagtacgcagtgcgtggcccc
atagtgcagcgagccttggagctggagcaggagctgcgccagggtgtgaagaagcctttc
accgaggtcatccgtgccaacatcggggacgcacaggctatggggcagaggcccatcacc
ttcctgcgccaggtcttggccctctgtgttaaccctgatcttctgagcagccccaacttc
cctgacgatgccaagaaaagggcggagcgcatcttgcaggcgtgtgggggccacagtctg
ggggcctacagcgtcagctccggcatccagctgatccgggaggacgtggcgcggtacatt
gagaggcgtgacggaggcatccctgcggaccccaacaacgtcttcctgtccacaggggcc
agcgatgccatcgtgacggtgctgaagctgctggtggccggcgagggccacacacgcacg
ggtgtgctcatccccatcccccagtacccactctactcggccacgctggcagagctgggc
gcagtgcaggtggattactacctggacgaggagcgtgcctgggcgctggacgtggccgag
cttcaccgtgcactgggccaggcgcgtgaccactgccgccctcgtgcgctctgtgtcatc
aaccctggcaaccccaccgggcaggtgcagacccgcgagtgcatcgaggccgtgatccgc
ttcgccttcgaagagcggctctttctgctggcggacgaggtgtaccaggacaacgtgtac
gccgcgggttcgcagttccactcattcaagaaggtgctcatggagatggggccgccctac
gccgggcagcaggagcttgcctccttccactccacctccaagggctacatgggcgagtgc
gggttccgcggcggctatgtggaggtggtgaacatggacgctgcagtgcagcagcagatg
ctgaagctgatgagtgtgcggctgtgcccgccggtgccaggacaggccctgctggacctg
gtggtcagcccgcccgcgcccaccgacccctcctttgcgcagttccaggctgagaagcag
gcagtgctggcagagctggcggccaaggccaagctcaccgagcaggtcttcaatgaggct
cctggcatcagctgcaacccagtgcagggcgccatgtactccttcccgcgcgtgcagctg
cccccgcgggcggtggagcgcgctcaggagctgggcctggcccccgatatgttcttctgc
ctgcgcctcctggaggagaccggcatctgcgtggtgccagggagcggctttgggcagcgg
gaaggcacctaccacttccggatgaccattctgccccccttggagaaactgcggctgctg
ctggagaagctgagcaggttccatgccaagttcaccctcgagtactcctga

DBGET integrated database retrieval system