KEGG   Homo sapiens (human): 2875Help
Entry
2875              CDS       T01001                                 

Gene name
GPT, AAT1, ALT1, GPT1
Definition
glutamic-pyruvate transaminase (alanine aminotransferase) (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2875 (GPT)
   01210 2-Oxocarboxylic acid metabolism
    2875 (GPT)
   01230 Biosynthesis of amino acids
    2875 (GPT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2875 (GPT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     2875 (GPT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   2875 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 496 aa AA seqDB search
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgagcacaggtgaccggagccaggcggtgaggcatggactgagggcgaaggtg
ctgacgctggacggcatgaacccgcgtgtgcggagagtggagtacgcagtgcgtggcccc
atagtgcagcgagccttggagctggagcaggagctgcgccagggtgtgaagaagcctttc
accgaggtcatccgtgccaacatcggggacgcacaggctatggggcagaggcccatcacc
ttcctgcgccaggtcttggccctctgtgttaaccctgatcttctgagcagccccaacttc
cctgacgatgccaagaaaagggcggagcgcatcttgcaggcgtgtgggggccacagtctg
ggggcctacagcgtcagctccggcatccagctgatccgggaggacgtggcgcggtacatt
gagaggcgtgacggaggcatccctgcggaccccaacaacgtcttcctgtccacaggggcc
agcgatgccatcgtgacggtgctgaagctgctggtggccggcgagggccacacacgcacg
ggtgtgctcatccccatcccccagtacccactctactcggccacgctggcagagctgggc
gcagtgcaggtggattactacctggacgaggagcgtgcctgggcgctggacgtggccgag
cttcaccgtgcactgggccaggcgcgtgaccactgccgccctcgtgcgctctgtgtcatc
aaccctggcaaccccaccgggcaggtgcagacccgcgagtgcatcgaggccgtgatccgc
ttcgccttcgaagagcggctctttctgctggcggacgaggtgtaccaggacaacgtgtac
gccgcgggttcgcagttccactcattcaagaaggtgctcatggagatggggccgccctac
gccgggcagcaggagcttgcctccttccactccacctccaagggctacatgggcgagtgc
gggttccgcggcggctatgtggaggtggtgaacatggacgctgcagtgcagcagcagatg
ctgaagctgatgagtgtgcggctgtgcccgccggtgccaggacaggccctgctggacctg
gtggtcagcccgcccgcgcccaccgacccctcctttgcgcagttccaggctgagaagcag
gcagtgctggcagagctggcggccaaggccaagctcaccgagcaggtcttcaatgaggct
cctggcatcagctgcaacccagtgcagggcgccatgtactccttcccgcgcgtgcagctg
cccccgcgggcggtggagcgcgctcaggagctgggcctggcccccgatatgttcttctgc
ctgcgcctcctggaggagaccggcatctgcgtggtgccagggagcggctttgggcagcgg
gaaggcacctaccacttccggatgaccattctgccccccttggagaaactgcggctgctg
ctggagaagctgagcaggttccatgccaagttcaccctcgagtactcctga

DBGET integrated database retrieval system