KEGG   Homo sapiens (human): 2877Help
Entry
2877              CDS       T01001                                 

Gene name
GPX2, GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
Definition
glutathione peroxidase 2 (gastrointestinal) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    2877 (GPX2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2877 (GPX2)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    2877 (GPX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2877 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.1
AA seq 190 aa AA seqDB search
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctttcattgccaagtccttctatgacctcagtgccatcagcctggatggggagaag
gtagatttcaatacgttccggggcagggccgtgctgattgagaatgtggcttcgctctga
ggcacaaccacccgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggtccttggcttcccttgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgtcctgggggtggataccagcccaccttcacc
cttgtccaaaaatgtgaggtgaatgggcagaacgagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttatgatgacccattttccctcatgaccgatcccaagctcatc
atttggagccctgtgcgccgctcagatgtggcctggaactttgagaagttcctcataggg
ccggagggagagcccttccgacgctacagccgcaccttcccaaccatcaacattgagcct
gacatcaagcgcctccttaaagttgccatatag

DBGET integrated database retrieval system