KEGG   Homo sapiens (human): 2878Help
Entry
2878              CDS       T01001                                 

Gene name
GPX3, GPx-P, GSHPx-3, GSHPx-P
Definition
glutathione peroxidase 3 (plasma) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    2878 (GPX3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2878 (GPX3)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    2878 (GPX3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2878 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23
AA seq 226 aa AA seqDB search
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctttccctgctcctggccggcttcgtctcg
cagagccggggacaagagaagtcgaagatggactgccatggtggcataagtggcaccatt
tacgagtacggagccctcaccattgatggggaggagtacatccccttcaagcagtatgct
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccagtacatt
gaactgaatgcactacaggaagagcttgcaccattcggtctggtcattctgggctttccc
tgcaaccaatttggaaaacaggaaccaggagagaactcagagatccttcctaccctcaag
tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtc
aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg
gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggttcacgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacccatcatgcgctggcaccac
cggaccacggtcagcaacgtcaagatggacatcctgtcctacatgaggcggcaggcagcc
ctgggggtcaagaggaagtaa

DBGET integrated database retrieval system