KEGG   Homo sapiens (human): 2878Help
Entry
2878              CDS       T01001                                 

Gene name
GPX3, GPx-P, GSHPx-3, GSHPx-P
Definition
glutathione peroxidase 3 (plasma) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23
AA seq 226 aa AA seqDB search
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctttccctgctcctggccggcttcgtctcg
cagagccggggacaagagaagtcgaagatggactgccatggtggcataagtggcaccatt
tacgagtacggagccctcaccattgatggggaggagtacatccccttcaagcagtatgct
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccagtacatt
gaactgaatgcactacaggaagagcttgcaccattcggtctggtcattctgggctttccc
tgcaaccaatttggaaaacaggaaccaggagagaactcagagatccttcctaccctcaag
tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtc
aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg
gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggttcacgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacccatcatgcgctggcaccac
cggaccacggtcagcaacgtcaagatggacatcctgtcctacatgaggcggcaggcagcc
ctgggggtcaagaggaagtaa

DBGET integrated database retrieval system