KEGG   Homo sapiens (human): 288Help
Entry
288               CDS       T01001                                 

Gene name
ANK3, ANKYRIN-G, MRT37
Definition
(RefSeq) ankyrin 3, node of Ranvier (ankyrin G)
  KO
K10380  
ankyrin
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    288 (ANK3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    288 (ANK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q21
AA seq 4377 aa AA seqDB search
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDI
TGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM
NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGG
QQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHK
KETESDQDDEIEKTDRRQSFASLALRKRYSYLTEPGMIERSTGATRSLPTTYSYKPFFST
RPYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSS
VKSISDVASPIRSFRTMSSPIKTVVSQSPYNIQVSSGTLARAPAVTEATPLKGLASNSTF
SSRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVS
PVKSAVDVISSAKITMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATAT
LQEKISSATNSVSSVVSAATDTVEKVFSTTTAMPFSPLRSYVSAAPSAFQSLRTPSASAL
YTSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSFTKSAAALLSPIKTLT
TETHPQPHFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQ
TDVPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGSPKSPKSD
KGHSPEDDWIEFSSEEIREARQQAAASQSPSLPERVQVKAKAASEKDYNLTKVIDYLTND
IGSSSLTNLKYKFEDAKKDGEERQKRVLKPAIALQEHKLKMPPASMRTSTSEKELCKMAD
SFFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPP
VITETRTEVVHVIRSYDPSAGDVPQTQPEEPVSPKPSPTFMELEPKPTTSSIKEKVKAFQ
MKASSEEDDHNRVLSKGMRVKEETHITTTTRMVYHSPPGGEGASERIEETMSVHDIMKAF
QSGRDPSKELAGLFEHKSAVSPDVHKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGNQA
EPTEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAE
ESLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGES
YRFAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDKRSREKIATAPKKEILSKIYK
DVSENGVGKVSKDEHFDKVTVLHYSGNVSSPKHAMWMRFTEDRLDRGREKLIYEDRVDRT
VKEAEEKLTEVSQFFRDKTEKLNDELQSPEKKARPKNGKEYSSQSPTSSSPEKVLLTELL
ASNDEWVKARQHGPDGQGFPKAEEKAPSLPSSPEKMVLSQQTEDSKSTVEAKGSISQSKA
PDGPQSGFQLKQSKLSSIRLKFEQGTHAKSKDMSQEDRKSDGQSRIPVKKIQESKLPVYQ
VFAREKQQKAIDLPDESVSVQKDFMVLKTKDEHAQSNEIVVNDSGSDNVKKQRTEMSSKA
MPDSFSEQQAKDLACHITSDLATRGPWDKKVFRTWESSGATNNKSQKEKLSHVLVHDVRE
NHIGHPESKSVDQKNEFMSVTERERKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGDH
PGGLLDQPSRRSESSAVSHIPVRVADERRMLSSNIPDGFCEQSAFPKHELSQKLSQSSMS
KETVETQHFNSIEDEKVTYSEISKVSKHQSYVGLCPPLEETETSPTKSPDSLEFSPGKES
PSSDVFDHSPIDGLEKLAPLAQTEGGKEIKTLPVYVSFVQVGKQYEKEIQQGGVKKIISQ
ECKTVQETRGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYE
FTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSTSLKQTTVEETAVEREMPNDVSKDS
NQRPKNNRVAYIEFPPPPPLDADQIESDKKHHYLPEKEVDMIEVNLQDEHDKYQLAEPVI
RVQPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEVDDEQKEKPKASAEKASNQKEL
ESNGSGKDNEFGLGLDSPQNEIAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDL
QDEDDGLTESDSKLPIQAMEIKKDIWNTEGILKPADRSFSQSKLEVIEEEGKVGPDEDKP
PSKSSSSEKTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGL
DFDPWSNNRGDDEVFDSKSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNP
FPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKSMVTATPQP
QSGDTTVETNLERNVETPTVEPNPSIPTSGECQEGTSSSGSLEKSAAATNTSKVDPKLRT
PIKMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETITMISNTANSQMGVRPHEKHD
FQKDNFNNNNNLDSSTIQTDNIMSNIVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCV
RDKQKVLGEQQKTKELIGIRQKSKLPIKATSPKDTFPPNHMSNTKASKMKQVSQSEKTKA
LTTSSCVDVKSRIPVKNTHRDNIIAVRKACATQKQGQPEKGKAKQLPSKLPVKVRSTCVT
TTTTTATTTTTTTTTTTTSCTVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEEKK
MQSELSDEEESTSRNTSLSETSRGGQPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRR
TGPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKK
WVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGW
QNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPE
AKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKP
CVPVSMKKMSRTSPADGKPRLSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS
NT seq 13134 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgcagcctcacaattaaagaaaaacagggatttagaaatcaatgctgaagaa
gagcctgagaaaaaaaggaaacaccgcaaacggtcccgggatcggaagaaaaagtctgat
gccaatgcaagttacttaagagcagctcgagctggacaccttgaaaaggccctcgactac
ataaaaaatggagttgacatcaacatttgcaatcagaatgggttgaacgctctccacctt
gcttccaaagaaggccatgtagaggttgtttctgagctgctgcagagagaagccaatgtg
gatgcagctacaaagaaaggaaacacagcattgcacatcgcatctttggctgggcaagca
gaggtggtaaaagtcttggttacaaatggagccaatgtcaatgcacaatctcagaatggt
ttcacgccattgtatatggcagcccaggaaaatcacctggaagttgtcaagtttcttctt
gacaatggtgcaagccagagcctagccacagaggatggcttcacaccattggcagtggct
ttgcaacaaggtcacgaccaagtcgtttcgctcctgctagagaatgacaccaaaggaaaa
gtgcgtctcccagctcttcatatcgcggcccgaaaagacgacacgaaagccgccgccctg
ctgctgcagaatgacaacaatgcagatgtggaatcaaagagtggcttcactccgctccac
atagctgctcactatggaaatatcaatgtagccacgttgctgttaaaccgagcggctgct
gtggatttcaccgcaaggaatgacatcactcctttacatgttgcatcaaaaagaggaaat
gcaaatatggtaaaactattgctcgatcgaggagctaaaatcgatgccaaaaccagggat
ggtctgacaccactgcactgtggagcaaggagtggccacgagcaggtggtagaaatgttg
cttgatcgagctgcccccattctttcaaaaaccaagaatggattatctccattgcacatg
gccacacaaggggatcatttaaactgcgtccagcttctcctccagcataatgtacccgtg
gatgatgtcaccaatgactacctgactgccctacacgtggctgcccactgtggccattac
aaagttgccaaggttctcttggataagaaagctaaccccaatgccaaagccctgaatggc
tttacccctcttcatattgcctgcaagaagaatcgaattaaagtaatggaactccttctg
aaacacggtgcatccatccaagctgtaaccgagtcgggccttaccccaatccatgttgct
gccttcatggggcatgtaaatattgtatcacaactaatgcatcatggagcctcaccaaac
accaccaatgtgagaggagaaacagcactgcacatggcagctcgctccggccaagctgaa
gttgtgcggtatctggtacaagacggagctcaggtagaagctaaagctaaggatgaccaa
acaccactccacatttcagcccgactggggaaagcagacatagtacaacagctgttgcag
caaggggcatctccaaatgcagccacaacttctgggtacaccccacttcacctttccgcc
cgagaggggcatgaggatgtggccgcgttccttttggatcatggagcgtctttatctata
acaacaaagaaaggatttactcctcttcatgtggcagcaaaatatggaaagcttgaagtc
gccaatctcctgctacagaaaagtgcatctccagatgctgctgggaagagcgggctaaca
ccactgcatgtagctgcacattacgataatcagaaagtggcccttctgcttttggaccaa
ggagcctcacctcacgcagccgcaaagaatggttatacgccactgcacatcgctgccaaa
aagaaccagatggacatagcgacaactctgctggaatatggtgctgatgccaacgcagtt
acccggcaaggaattgcttccgtccatctcgcagctcaggaagggcacgtggacatggtg
tcgctgctcctcggtagaaatgcgaatgtgaacctgagcaataagagcggcctgacccca
ctccatttggctgctcaagaagatcgagtgaatgtggcagaagtcctcgtaaaccaaggg
gctcatgtggacgcccagacaaagatgggatacacaccactgcatgtgggctgccactat
ggaaatatcaagattgttaatttcctgctccagcattctgcaaaagttaatgccaaaaca
aagaatgggtatacgccattacatcaagcagcacagcaggggcatacgcatataataaat
gtcttacttcagaacaacgcctcccccaatgaactcactgtgaatgggaatactgccctt
ggcattgcccggcgcctcggctacatctcagtagtggacaccctgaagatagtgaccgaa
gagaccatgaccacaactactgtcacagagaagcacaaaatgaatgttccagaaacgatg
aatgaagttcttgatatgtctgatgatgaagttcgtaaagccaatgcccctgaaatgctc
agtgatggcgaatatatctcagatgttgaagaaggtgaagatgcaatgaccggggacaca
gacaaatatcttgggccacaggaccttaaggaattgggtgatgattccctgcctgcagag
ggttacatgggctttagtctcggagcgcgttctgccagcctccgctccttcagttcggat
aggtcttacaccttgaacagaagctcctatgcacgggacagcatgatgattgaagaactc
cttgtgccatccaaagagcagcatctaacattcacaagggaatttgattcagattctctt
agacattacagctgggctgcagacaccttagacaatgtcaatcttgtttcaagccccatt
cattctgggtttctggttagctttatggtggacgcgagagggggctccatgagaggaagc
cgtcatcacgggatgagaatcatcattcctccacgcaagtgtacggcccccactcgaatc
acctgccgtttggtaaagagacataaactggccaacccaccccccatggtggaaggagag
ggattagccagtaggctggtagaaatgggtcctgcaggggcacaatttttaggccctgtc
atagtggaaatccctcactttgggtccatgagaggaaaagagagagaactcattgttctt
cgaagtgaaaatggtgaaacttggaaggagcatcagtttgacagcaaaaatgaagattta
accgagttacttaatggcatggatgaagaacttgatagcccagaagagttagggaaaaag
cgtatctgcaggattatcacgaaagatttcccccagtattttgcagtggtttcccggatt
aagcaggaaagcaaccagattggtcctgaaggtggaattctgagcagcaccacagtgccc
cttgttcaagcatctttcccagagggtgccctaactaaaagaattcgagtgggcctccag
gcccagcctgttccagatgaaattgtgaaaaagatccttggaaacaaagcaacttttagc
ccaattgtcactgtggaaccaagaagacggaaattccataaaccaatcacaatgaccatt
ccggtgcccccgccctcaggagaaggtgtatccaatggatacaaaggggacactacaccc
aatctgcgtcttctctgtagcattacagggggcacttcgcctgctcagtgggaagacatc
acaggaacaactcctttgacgtttataaaagattgtgtctcctttacaaccaatgtttca
gccagattttggcttgcagactgccatcaagttttagaaactgtggggttagccacgcaa
ctgtacagagaattgatatgtgttccatatatggccaagtttgttgtttttgccaaaatg
aatgatcccgtagaatcttccttgcgatgtttctgcatgacagatgacaaagtggacaaa
actttagagcaacaagagaattttgaggaagtcgcaagaagcaaagatattgaggttctg
gaaggaaaacctatttatgttgattgttatggaaatttggccccacttaccaaaggagga
cagcaacttgtttttaacttttattctttcaaagaaaatagactgccattttccatcaag
attagagacaccagccaagagccctgtggtcgtctgtcttttctgaaagaaccaaagaca
acaaaaggactgcctcaaacagcggtttgcaacttaaatatcactctgccagcacataaa
aaggagacagagtcagatcaagatgatgagattgagaaaacagatagacgacagagcttc
gcatccttagctttacgtaagcgctacagctacttgactgagcctggaatgattgaacgg
agtacaggagcaacaagatccctccccaccacttactcatacaagccattcttttctaca
agaccataccagtcctggacaacagctccgattacagtgcctgggccagccaagtcaggc
ttcacttccttatcaagttcttcctctaatacgccatcagcttctccgttaaaatcaata
tggtctgtttcgacaccttctccaatcaaatccacattaggcgcgtcaactacatcttca
gttaaatccattagtgacgtggcatctccaattagatcctttcggacaatgtcttcgccg
ataaaaactgtggtgtcacaatctccatacaatatccaagtttcctctggtaccctggct
agagctccagcagtcacggaagctacgcccttaaaagggctggcatccaattctacgttt
tcctctcgaacctctccagtgactacagcagggtctcttttggagaggtcatcaattact
atgacaccccctgcctcccccaaatcaaacattaatatgtattcctcaagtttgccattt
aagtcaattattacatcagcagcaccgctaatatcttcacctttaaagtcagtggtgtct
ccagttaaatcagcagttgatgtcatttcatcagccaaaattacaatggcatcttctctc
tcatcacctgtgaagcagatgcctggacatgcagaggtagcattagtcaatggatctatt
tcccctctaaaatatccatcatcctcaactttaattaatggatgcaaagccactgccacg
ttacaggaaaaaatttcttctgctacaaactctgtgagctctgtggtcagtgcagccact
gacacagttgagaaagtgttttctaccacgactgcaatgccattttccccactcaggtca
tatgtttctgcagcaccatcagcttttcagtctctaagaactccttccgcaagtgcactc
tatacatcccttgggtcgtcaatatctgcaactacctcatctgtaacttcatcaattata
acagtgccagtatactctgtagtcaatgttttgccagaaccagcattaaagaaacttcca
gactctaattcatttacaaaatcagcagcagccttgctgtcacccattaaaacattgact
acggagacacatcctcagcctcacttcagtcgaacttcatctccagttaagtcatctttg
ttccttgcaccctctgcccttaagttgtctacaccatcttctttatcttccagtcaggag
atactaaaagatgtagctgaaatgaaagaggacctaatgcggatgaccgcaatactacag
acagatgtgcctgaggagaagccattccaacctgaactcccaaaggaagggagaatagat
gatgaagaacctttcaaaattgtagagaaagtaaaggaagacttagtgaaagttagtgaa
atccttaaaaaggatgtatgtgtagataataaaggatcacccaaatcaccaaagagtgac
aaaggacactctcctgaagatgactggatagaatttagttcggaagaaatccgggaagcc
agacaacaagctgctgcgagccagtctccatctctgccagagagagtgcaagtaaaagca
aaagccgcctccgaaaaggattataacttgaccaaagttattgattacctaacaaatgat
attgggagtagttcactgacaaacttaaaatacaagtttgaggatgcaaagaaggatggt
gaggagagacagaaaagagttttaaaaccagcaattgctttgcaggaacacaaactcaaa
atgcctccagcctccatgaggacttccacctctgagaaagaattgtgtaaaatggctgat
tccttttttggaacagatactattttagagtctcctgatgacttttctcaacacgaccaa
gataaaagtcccttgtctgacagtggctttgaaacaagaagtgaaaagacaccttcagcc
ccacaaagcgctgaaagcactggtcctaaaccactttttcatgaagttcccatccctcct
gtcattacagaaacaagaactgaagtggttcatgttatcaggagctatgatccctcagct
ggggatgttccccagacccaaccagaggagcctgtgtcacctaaaccttcacctactttt
atggaattggaaccaaagcccaccacctctagtattaaagaaaaggttaaagcatttcaa
atgaaagccagtagtgaagaagatgaccacaatcgggttttaagcaaaggcatgcgtgtt
aaagaagagactcacataaccacaaccaccagaatggtttatcattctccaccaggcggt
gaaggtgcatctgaaagaattgaagaaaccatgtcagtccatgacatcatgaaggccttt
cagtccgggcgggatccttccaaagaactggcaggtctgtttgaacataagtcggcagtg
tctccagatgttcacaagtctgctgctgaaacctcagcccagcatgcagagaaggacaac
caaatgaaacccaaactggagcgtataatagaagtccacatcgaaaaaggtaaccaagct
gagcccactgaagtcattattagagaaaccaaaaagcatccagaaaaagaaatgtatgta
tatcagaaagacttatcccggggagatattaacctaaaagattttctgccagaaaaacac
gatgcttttccttgttcagaggaacagggtcagcaagaagaagaagaacttactgctgaa
gagtcattgccttcttatctggagtcttccagagtaaacactcctgtgtcccaagaagaa
gatagccgccctagttctgctcaactcatatctgatgactcttataaaacattgaagctt
ttgagtcaacactcaatagaataccatgacgatgagttgtcagaactaagaggggagtct
tacaggtttgctgagaaaatgcttctgtcagaaaagctagatgtgtctcattctgatact
gaggaatcggttacagaccatgcaggaccccctagctcagagttacaggggtctgataag
cggtccagagaaaaaatagccactgcccccaaaaaagaaattctctccaaaatctataaa
gatgtttctgaaaatggtgtaggtaaagtgtctaaagatgagcattttgataaagtgaca
gtgttgcactattctggcaatgttagtagtccaaaacatgccatgtggatgcgctttact
gaggacagattagacagaggtagagagaagttgatatatgaagatagggtggacaggact
gtgaaggaggctgaagaaaaactgactgaagtgtcacagttttttcgtgacaaaactgaa
aagctaaatgatgaactgcagtccccagagaaaaaggcacgccctaaaaatggcaaagaa
tattcttctcaaagccctaccagtagcagccctgagaaagtgctactgacagaactgctg
gcatccaatgatgagtgggttaaggcaagacagcatggccctgatggacaaggcttcccc
aaggccgaggagaaggcacccagtctgcccagcagcccagagaagatggttctctcccaa
cagactgaggacagcaagtccacagtggaagccaaaggaagtatttcacagagcaaagca
ccagatgggccccagtctggattccagctcaaacaatctaaactcagttccattagatta
aaatttgaacaaggcacacacgcaaaaagtaaggacatgtctcaagaagacagaaagtca
gatggccagtccagaatcccagttaaaaaaatacaggagagcaagctacccgtctaccaa
gtttttgctagagaaaaacagcagaaggccatagacctcccagatgaaagtgtatctgtg
caaaaagattttatggtattaaaaaccaaagatgagcatgcccaaagcaacgaaattgtt
gtaaatgattctggctctgataatgtgaaaaaacagagaactgaaatgtcaagtaaagca
atgcctgactctttttctgagcagcaggctaaagacttggcatgtcatataacctcagat
ttagcaactaggggaccatgggacaaaaaggtctttagaacatgggagagttcgggagcc
actaacaataagtctcagaaagaaaaactttcgcatgtacttgttcatgatgtaagagag
aatcacattggtcaccctgagagtaaaagtgttgatcaaaagaatgaatttatgtctgtg
actgagagagaacgcaaattgttaacaaacggctctctctcagaaattaaagaaatgact
gtaaaatctccctccaaaaaagtcttatatagggaatatgttgtgaaagaaggggaccat
ccaggcggattgcttgatcagccttccaggaggagcgagagctcagcagtgtcacacatt
cccgtcagagttgctgatgagaggagaatgctgtcttctaatattcccgatggtttttgt
gaacagtcggcatttccaaaacatgaactatcacaaaaattgtcccagtcaagcatgagt
aaagagacagttgagacacagcactttaattctatagaagatgaaaaagttacctattca
gaaatcagcaaagtttccaaacaccagagttatgtaggtttatgcccacctctcgaggaa
accgaaacctcccccaccaaatctcctgattctttagagtttagcccaggaaaggaatct
ccctctagtgatgtattcgaccacagtcccattgatggattggaaaaactcgcaccacta
gcccagacagagggagggaaagagataaaaactttacccgtttatgtcagttttgtacaa
gtggggaagcaatatgaaaaggagatacaacaaggaggtgtaaaaaaaatcataagtcag
gaatgtaagacagtacaagaaaccagggggaccttttatacaactagacagcaaaagcaa
cctccttctccccaaggtagtccagaagatgatactctagagcaagtatcctttctagac
agctctgggaaaagccctttaaccccagaaacacccagttcagaggaagtgagttatgaa
tttacatctaagacacctgactcgctcatagcttatataccaggcaaacccagcccaatt
cccgaggtttctgaggagtcagaggaggaggaacaggccaagtcaacctcccttaagcag
actacagtggaggaaacagcagttgagcgtgaaatgcctaatgacgtgagcaaagactct
aaccaaagacccaaaaataacagagttgcctatattgaatttccccctcctccaccactg
gatgcggaccagattgagtcagataagaagcatcattatctcccagaaaaagaggttgac
atgattgaagtcaatctgcaagatgagcatgacaagtaccagctggctgaacctgtcatt
agagtgcagccaccttcaccagttcctcccggggcagacgtcagtgattcaagcgatgac
gaatctatttatcagccagtcccagttaaaaaatataccttcaaattaaaggaagtggac
gatgaacaaaaagaaaaacccaaagcttctgctgaaaaggcttccaaccagaaagaactg
gaaagtaatggatctggaaaagataatgaatttggccttggccttgattcacctcagaat
gaaattgcccagaatgggaacaacgaccagtccatcacagagtgttccattgccaccaca
gcagagttttctcatgacacggatgccacagagatcgactctctggatggctatgacctg
caagatgaagatgatggcttgacagagagtgattctaaactcccaattcaagccatggaa
attaagaaagatatctggaacacagagggcattctgaagccagctgaccgctcttttagc
caaagtaaacttgaagttatcgaggaggagggaaaggtgggaccagatgaggacaagcca
ccttctaaaagttcttcatctgaaaagactcctgataagactgatcagaagtcaggggcc
cagttcttcacactggaaggcagacatcctgacagatcagtgtttcctgatacttacttc
agttacaaagtagatgaagaatttgccactccttttaaaacagtagctaccaaaggtcta
gattttgacccttggtctaataaccgaggggatgatgaagtttttgacagtaaatcacgg
gaagatgaaactaagccatttgggctggcggtagaagaccgctctccagcaacaacccct
gatacaacgccagccagaacgccaactgatgaaagtaccccaactagtgagcctaacccc
ttcccatttcatgaaggaaaaatgtttgagatgactcgcagtggtgcaattgacatgagc
aagagggattttgttgaagagaggctccaatttttccagattggtgagcatacttctgaa
gggaagtcaggggaccagggggaaggggataaaagtatggtcactgccacaccacagcca
cagtcaggggacaccactgtagaaaccaatctagagagaaatgtagagacacctacagtg
gaacctaaccccagcatcccgaccagcggagagtgtcaggaaggcacatccagtagtggc
tccctggagaaatcagcagcagccactaacacctctaaagttgaccccaagttgcgcacg
cctataaaaatgggaatttctgcatccaccatgaccatgaagaaagaaggccctggagaa
ataacagataagatagaagcggtgatgaccagttgtcagggattagaaaatgaaactata
acaatgatttcaaatacagccaatagccagatgggcgttaggccccatgaaaaacatgat
tttcaaaaagataactttaataacaacaacaatttggattcttccactatacagacagat
aacattatgagtaatatagttctgacagaacattctgcacccacttgtaccacagagaaa
gataacccagtgaaagtctcatcaggaaaaaagacaggggtactacaaggacactgtgta
agagataagcagaaagttcttggagaacagcaaaaaacaaaggaattgatagggattagg
caaaaatccaaacttcccataaaggccacttcaccaaaagataccttcccaccgaaccat
atgtcaaacactaaagcaagtaaaatgaagcaggttagtcaatccgagaaaaccaaagcc
cttactacttcttcatgtgtagatgtaaagtccagaattccagtgaaaaacacacacagg
gataacataattgcagttagaaaagcatgtgccacacaaaagcaagggcagccagagaaa
ggcaaggccaaacagcttccatccaagttgccagtaaaggtaagatccacctgtgtcact
accaccaccaccactgccaccaccaccaccactaccaccactaccaccaccaccagctgc
acagttaaagttaggaaaagtcagctcaaggaagtatgtaaacattccattgaatatttt
aagggaattagtggtgagaccttaaagcttgtggaccgcctctctgaagaagaaaaaaag
atgcagtccgagttgtccgatgaggaagaaagtacctcaagaaacacgtcgttgtccgag
acttcccggggtggccagccttcggttacaacgaagtctgctagagataagaaaacagag
gcagcacctttaaaatcaaagagtgaaaaggccggcagtgagaaaaggagcagtagaagg
actggtccacagagtccatgtgaacggacagatatcaggatggcaatagtagccgatcac
ctgggacttagttggacagaactggcaagggaactgaatttttcagtggatgaaatcaat
caaatacgtgtggaaaatccaaattctttaatttctcagagcttcatgttattaaaaaaa
tgggttaccagagacggaaaaaatgccacaactgatgccttaacttcggtcttgacaaaa
attaatcgaatagatatagtgacactgctagaaggaccaatatttgattatggaaatatt
tcaggcaccagaagttttgcagatgagaacaatgttttccatgaccctgttgatggttgg
cagaatgagacatcaagtggaaacctagagtcctgcgctcaagctcgaagagtaactggt
gggttactagatcgactggatgacagccctgaccagtgtagagattccattacctcatat
ctcaaaggagaagctggcaaatttgaagcaaatggaagccatacagaaatcactccagaa
gcaaagacaaaatcttactttccagaatcccaaaatgatgtaggaaaacagagtaccaag
gaaactctgaaaccaaaaatacatggatctggtcatgttgaagaaccagcatcaccacta
gcagcatatcagaaatctctagaagaaaccagcaagcttataatagaagagactaaaccc
tgtgtgcctgtcagtatgaaaaagatgagtaggacttctccagcagatggcaagccaagg
cttagcctccatgaagaagaggggtccagtgggtctgagcaaaagcagggagaaggtttt
aaggtgaaaacgaagaaagaaatccggcatgtggaaaagaagagccactcgtaa

DBGET integrated database retrieval system