KEGG   Homo sapiens (human): 2882Help
Entry
2882              CDS       T01001                                 

Gene name
GPX7, CL683, GPX6, GPx-7, GSHPx-7, NPGPx
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    2882 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2882 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    2882 (GPX7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2882 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Acyl-CoA_dh_C
Motif
Other DBs
NCBI-GeneID: 2882
NCBI-ProteinID: NP_056511
OMIM: 615784
HGNC: 4559
Ensembl: ENSG00000116157
Vega: OTTHUMG00000008322
Pharos: Q96SL4(Tbio)
UniProt: Q96SL4
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 187 aa AA seqDB search
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV
TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLI
LLKREDL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgacggtggcagcggcgtggctgctcctgtgggctgcggcctgcgcgcag
caggagcaggacttctacgacttcaaggcggtcaacatccggggcaaactggtgtcgctg
gagaagtaccgcggatcggtgtccctggtggtgaatgtggccagcgagtgcggcttcaca
gaccagcactaccgagccctgcagcagctgcagcgagacctgggcccccaccactttaac
gtgctcgccttcccctgcaaccagtttggccaacaggagcctgacagcaacaaggagatt
gagagctttgcccgccgcacctacagtgtctcattccccatgtttagcaagattgcagtc
accggtactggtgcccatcctgccttcaagtacctggcccagacttctgggaaggagccc
acctggaacttctggaagtacctagtagccccagatggaaaggtggtaggggcttgggac
ccaactgtgtcagtggaggaggtcagaccccagatcacagcgctcgtgaggaagctcatc
ctactgaagcgagaagacttataa

DBGET integrated database retrieval system