KEGG   Homo sapiens (human): 2889Help
Entry
2889              CDS       T01001                                 

Gene name
RAPGEF1, C3G, GRF2
Definition
(RefSeq) Rap guanine nucleotide exchange factor (GEF) 1
  KO
K06277  
Rap guanine nucleotide exchange factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Focal adhesion
Neurotrophin signaling pathway
Insulin signaling pathway
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2889 (RAPGEF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    2889 (RAPGEF1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2889 (RAPGEF1)
  Nervous system
   04722 Neurotrophin signaling pathway
    2889 (RAPGEF1)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    2889 (RAPGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 1094 aa AA seqDB search
MSGGLGLRRSPEMSGKIEKADSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKI
PEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVSA
LRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLA
NLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSS
PASKPDGPAELPLTDREVEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDNSPP
PALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYGG
ESPRLSPCSSIGKLSKSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQI
PQQTAWNLSPLPESLGESGSPFLGPPFQLPLGGHPQPDGPLAPGQQTDTPPALPEKKRRS
AASQTADGSGCRVSYERHPSQYDNISGEDLQSTAPIPSVPYAPFAAILPFQHGGSSAPVE
FVGDFTAPESTGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQKN
KLLMEVYGFSDSFSGVDSVQELAPPPALPPKQRQLEPPAGKDGHPRDPSAVSGVPGKDSR
DGSERAPKSPDALESAQSEEEVDELSLIDHNEIMSRLTLKQEGDDGPDVRGGSGDILLVH
ATETDRKDLVLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLV
RVVDELCLVELTEEILKLLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSSQP
LAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFT
EHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRR
LEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYI
DGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKP
RNITRRKTDREEKT
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcctcggcctccggcgcagcccggaaatgtccggcaagatcgagaaagca
gactctcagcgttctcatctctcttccttcaccatgaagctgatggacaaattccactca
cccaaaatcaagagaacgccatcaaagaagggaaaaccagctgaggtgtccgtaaagatt
ccagagaagcctgtgaacaaagaggcaacagacagatttctaccagagggctaccctctc
cccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggcttccagg
tctcaaaggcagaagaacctgagctggctggaggagaaagagaaggaagttgtcagtgcc
ctgcgctactttaagaccattgtggacaaaatggcaattgataagaaggtactggagatg
cttccagggtcagccagcaaggtgctggaggccatcttacccctggtgcagaacgatcct
cgaattcagcacagctcagccctctcttcctgctatagccgagtgtaccaaagcctcgcc
aacctcattcgctggtctgaccaagtgatgctggaaggcgtgaactcagaagacaaggag
atggtgacgactgtgaagggggtcatcaaggctgtgctggatggagtgaaggagctggtc
aggctcaccatcgagaagcagggacgtccgtctccgacgagccccgtgaagcccagttcc
cctgccagcaagcctgatggcccagcagagctccccctgacagaccgcgaggtagagatc
ctaaacaagacgactgggatgtcacagtcaactgagctcctcccagatgccacggatgaa
gaggtcgcgccccccaagcctcctctgcctggcattcgggtggttgataatagtcctcca
ccagcattgccacccaagaaaagacagtcggcgccgtcccctacccgagtggctgtggtg
gcccccatgagccgagccaccagtggctccagtttgcctgttggaatcaataggcaggat
tttgatgttgactgttacgcacagaggcgactgtcaggaggcagccactcatatggtgga
gagtcgccccgcctctccccctgcagcagcataggcaagctcagcaagtcagacgagcag
ctgtcctctctggacagggacagtgggcagtgctcccggaacacaagctgtgaaacacta
gaccactatgatcccgactatgaattcctccagcaagacctctctaacgcagaccagata
cctcagcagacggcctggaaccttagcccgttgccagagtctttgggggagtctgggtct
ccatttcttggccctcctttccagctgcctcttggcggccatccccagccagacggacct
ctggccccagggcagcagacagatacgccacctgctctccccgagaagaagcgcaggagc
gcagcctcccagacggcggacggctctggctgcagggtgtcctacgagcggcatccctcg
cagtatgacaacatctctggggaggacctgcagagcacagccccgatcccatccgtcccc
tacgcgccctttgctgctattctgccctttcagcatggaggttcctcagcccctgtcgaa
tttgtgggtgattttactgctcctgagtcaaccggtgacccagaaaaaccacctcctcta
ccagagaagaaaaacaaacacatgctggcctacatgcagttgctggaggactactcggag
ccgcagccctctatgttctaccagacgccacagaacgagcacatctaccagcagaagaac
aagctcctcatggaggtatacggcttcagcgactccttcagtggggtggactccgtgcag
gagctggccccgccgcccgccctaccccccaagcagcggcagctggagccaccggctggg
aaagacggacatcccagagatccctcagcggtcagcggcgtccctgggaaggacagcaga
gacggcagtgagagggccccaaagtcaccagatgctctggagtcggctcagtcggaggag
gaagtggacgagctgtccctcattgaccacaacgaaattatgtccaggctgacgctcaag
caggagggtgatgacgggccggacgtccgcggaggatctggggacatcttactggtccat
gctactgagactgacaggaaagatttggtgttgtactgcgaggcattcctgaccacctac
aggaccttcatctccccagaggagctcatcaagaagctgcagtacagatatgagaaattc
tctccctttgccgacacattcaagaagcgcgtcagcaagaacacgttcttcgtgctggta
cgggtggtggatgagctctgcctggtggagttgacagaagagatcctgaagctgctgatg
gaactggtcttccgcctggtgtgcaatggggagctgagcctggcccgtgtgctccggaag
aacatcctggacaaggtggaccagaagaagctactcaggtgtgccacctccagccagccc
ctggcagcccggggggtagcagccaggccggggaccttgcacgactttcacagccatgag
atagcggagcagctaacgctgctggatgctgagctcttctataaaatagagattcctgag
gttttgctttgggcaaaagagcagaatgaggagaagagccccaacttgacccagttcacg
gagcacttcaacaacatgtcctactgggtccggtccataatcatgttacaggaaaaggcc
caggacagggaacggctgctcttgaagttcatcaagatcatgaagcacttgcggaagctg
aataacttcaactcctacttggccatcctctctgccctggactcggcgcccatccgcagg
ctggagtggcagaagcagacttcagagggcctggccgagtactgcacactgatcgacagc
tcgtcctccttccgagcctaccgggccgccctctcggaggtggaaccgccgtgcatcccg
tacctggggctgatcctgcaggacctgaccttcgttcacctgggaaacccagactacatc
gacgggaaagtgaacttctccaagcggtggcagcagttcaacatcctcgacagcatgcgc
tgcttccagcaggcgcactatgacatgcggaggaacgacgacattataaacttcttcaat
gacttcagtgaccacctggctgaggaggccctatgggaactgtctctgaaaattaaaccc
aggaacataacaaggagaaaaacagaccgggaagagaagacctag

DBGET integrated database retrieval system