KEGG   Homo sapiens (human): 2889Help
Entry
2889              CDS       T01001                                 

Gene name
RAPGEF1, C3G, GRF2
Definition
Rap guanine nucleotide exchange factor (GEF) 1
Orthology
K06277  
Rap guanine nucleotide exchange factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Focal adhesion
Neurotrophin signaling pathway
Insulin signaling pathway
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 1077 aa AA seqDB search
MDTDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEG
YPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVSALRYFKTIVDKMAIDKKV
LEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSE
DKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASKPDGPAELPLTDRE
VEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDNSPPPALPPKKRQSAPSPTRV
AVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYGGESPRLSPCSSIGKLSKS
DEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQIPQQTAWNLSPLPESLGE
SGSPFLGPPFQLPLGGHPQPDGPLAPGQQTDTPPALPEKKRRSAASQTADGSGCRVSYER
HPSQYDNISGEDLQSTAPIPSVPYAPFAAILPFQHGGSSAPVEFVGDFTAPESTGDPEKP
PPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQKNKLLMEVYGFSDSFSGVD
SVQELAPPPALPPKQRQLEPPAGKDGHPRDPSAVSGVPGKDSRDGSERAPKSPDALESAQ
SEEEVDELSLIDHNEIMSRLTLKQEGDDGPDVRGGSGDILLVHATETDRKDLVLYCEAFL
TTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLVELTEEILK
LLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSSQPLAARGVAARPGTLHDFH
SHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQ
EKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTL
IDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILD
SMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggacacagactctcagcgttctcatctctcttccttcaccatgaagctgatggacaaa
ttccactcacccaaaatcaagagaacgccatcaaagaagggaaaaccagctgaggtgtcc
gtaaagattccagagaagcctgtgaacaaagaggcaacagacagatttctaccagagggc
taccctctccccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtg
gcttccaggtctcaaaggcagaagaacctgagctggctggaggagaaagagaaggaagtt
gtcagtgccctgcgctactttaagaccattgtggacaaaatggcaattgataagaaggta
ctggagatgcttccagggtcagccagcaaggtgctggaggccatcttacccctggtgcag
aacgatcctcgaattcagcacagctcagccctctcttcctgctatagccgagtgtaccaa
agcctcgccaacctcattcgctggtctgaccaagtgatgctggaaggcgtgaactcagaa
gacaaggagatggtgacgactgtgaagggggtcatcaaggctgtgctggatggagtgaag
gagctggtcaggctcaccatcgagaagcagggacgtccgtctccgacgagccccgtgaag
cccagttcccctgccagcaagcctgatggcccagcagagctccccctgacagaccgcgag
gtagagatcctaaacaagacgactgggatgtcacagtcaactgagctcctcccagatgcc
acggatgaagaggtcgcgccccccaagcctcctctgcctggcattcgggtggttgataat
agtcctccaccagcattgccacccaagaaaagacagtcggcgccgtcccctacccgagtg
gctgtggtggcccccatgagccgagccaccagtggctccagtttgcctgttggaatcaat
aggcaggattttgatgttgactgttacgcacagaggcgactgtcaggaggcagccactca
tatggtggagagtcgccccgcctctccccctgcagcagcataggcaagctcagcaagtca
gacgagcagctgtcctctctggacagggacagtgggcagtgctcccggaacacaagctgt
gaaacactagaccactatgatcccgactatgaattcctccagcaagacctctctaacgca
gaccagatacctcagcagacggcctggaaccttagcccgttgccagagtctttgggggag
tctgggtctccatttcttggccctcctttccagctgcctcttggcggccatccccagcca
gacggacctctggccccagggcagcagacagatacgccacctgctctccccgagaagaag
cgcaggagcgcagcctcccagacggcggacggctctggctgcagggtgtcctacgagcgg
catccctcgcagtatgacaacatctctggggaggacctgcagagcacagccccgatccca
tccgtcccctacgcgccctttgctgctattctgccctttcagcatggaggttcctcagcc
cctgtcgaatttgtgggtgattttactgctcctgagtcaaccggtgacccagaaaaacca
cctcctctaccagagaagaaaaacaaacacatgctggcctacatgcagttgctggaggac
tactcggagccgcagccctctatgttctaccagacgccacagaacgagcacatctaccag
cagaagaacaagctcctcatggaggtatacggcttcagcgactccttcagtggggtggac
tccgtgcaggagctggccccgccgcccgccctaccccccaagcagcggcagctggagcca
ccggctgggaaagacggacatcccagagatccctcagcggtcagcggcgtccctgggaag
gacagcagagacggcagtgagagggccccaaagtcaccagatgctctggagtcggctcag
tcggaggaggaagtggacgagctgtccctcattgaccacaacgaaattatgtccaggctg
acgctcaagcaggagggtgatgacgggccggacgtccgcggaggatctggggacatctta
ctggtccatgctactgagactgacaggaaagatttggtgttgtactgcgaggcattcctg
accacctacaggaccttcatctccccagaggagctcatcaagaagctgcagtacagatat
gagaaattctctccctttgccgacacattcaagaagcgcgtcagcaagaacacgttcttc
gtgctggtacgggtggtggatgagctctgcctggtggagttgacagaagagatcctgaag
ctgctgatggaactggtcttccgcctggtgtgcaatggggagctgagcctggcccgtgtg
ctccggaagaacatcctggacaaggtggaccagaagaagctactcaggtgtgccacctcc
agccagcccctggcagcccggggggtagcagccaggccggggaccttgcacgactttcac
agccatgagatagcggagcagctaacgctgctggatgctgagctcttctataaaatagag
attcctgaggttttgctttgggcaaaagagcagaatgaggagaagagccccaacttgacc
cagttcacggagcacttcaacaacatgtcctactgggtccggtccataatcatgttacag
gaaaaggcccaggacagggaacggctgctcttgaagttcatcaagatcatgaagcacttg
cggaagctgaataacttcaactcctacttggccatcctctctgccctggactcggcgccc
atccgcaggctggagtggcagaagcagacttcagagggcctggccgagtactgcacactg
atcgacagctcgtcctccttccgagcctaccgggccgccctctcggaggtggaaccgccg
tgcatcccgtacctggggctgatcctgcaggacctgaccttcgttcacctgggaaaccca
gactacatcgacgggaaagtgaacttctccaagcggtggcagcagttcaacatcctcgac
agcatgcgctgcttccagcaggcgcactatgacatgcggaggaacgacgacattataaac
ttcttcaatgacttcagtgaccacctggctgaggaggccctatgggaactgtctctgaaa
attaaacccaggaacataacaaggagaaaaacagaccgggaagagaagacctag

DBGET integrated database retrieval system