KEGG   Homo sapiens (human): 2890Help
Entry
2890              CDS       T01001                                 

Gene name
GRIA1, GLUH1, GLUR1, GLURA, GluA1, HBGR1
Definition
glutamate receptor, ionotropic, AMPA 1
Orthology
K05197  
glutamate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Long-term depression
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Nicotine addiction
Drug target
Topiramate: 
Perampanel: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2890 (GRIA1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2890 (GRIA1)
   04728 Dopaminergic synapse
    2890 (GRIA1)
   04720 Long-term potentiation
    2890 (GRIA1)
   04730 Long-term depression
    2890 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    2890 (GRIA1)
  Environmental adaptation
   04713 Circadian entrainment
    2890 (GRIA1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    2890 (GRIA1)
  Substance dependence
   05031 Amphetamine addiction
    2890 (GRIA1)
   05033 Nicotine addiction
    2890 (GRIA1)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2890 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgtaggactgtcaacatgctgacctccttt
tgtggggccctccacgtctgcttcattacgccgagctttcccgttgatacatccaatcag
tttgtccttcagctgcgccctgaactgcaggatgccctcatcagcatcattgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccggggcttatccgtcctgcagaaa
gtcctggatacagctgctgagaagaactggcaggtgacagcagtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacctggagaagaaaaaggagcggctggtg
gtggtggactgtgaatcagaacgcctcaatgctatcttgggccagattataaagctagag
aagaatggcatcggctaccactacattcttgcaaatctgggcttcatggacattgactta
aacaaattcaaggagagtggcgccaatgtgacaggtttccagctggtgaactacacagac
actattccggccaagatcatgcagcagtggaagaatagtgatgctcgagaccacacacgg
gtggactggaagagacccaagtacacctctgcgctcacctacgatggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaattgatatatctcgccgggggaatgct
ggggattgtctggctaacccagctgttccctggggccaagggatcgacatccagagagct
ctgcagcaggtgcgatttgaaggtttaacaggaaacgtgcagtttaatgagaaaggacgc
cggaccaactacacgctccacgtgattgaaatgaaacatgacggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgcccaagctgggggcgat
aattcaagtgttcagaacagaacatacatcgtcacaacaatcctagaagatccttatgtg
atgctcaagaagaacgccaatcagtttgagggcaatgaccgttacgagggctactgtgta
gagctggcggcagagattgccaagcacgtgggctactcctaccgtctggagattgtcagt
gatggaaaatacggagcccgagaccctgacacgaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtggctcccttaactatcactttggtccgggaa
gaagttatagatttctccaaaccatttatgagtttggggatctccatcatgattaaaaaa
ccacagaaatccaagccgggtgtcttctccttccttgatcctttggcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagtgttgtcctcttcctggtcagccgcttc
agtccctatgaatggcacagtgaagagtttgaggaaggacgggaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagtttgtggttctccctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtctggtcgcatcgttggtggcgtctggtgg
ttcttcaccttaatcatcatctcctcatatacagccaatctggccgccttcctgaccgtg
gagaggatggtgtctcccattgagagtgcagaggacctagcgaagcagacagaaattgcc
tacgggacgctggaagcaggatctactaaggagttcttcaggaggtctaaaattgctgtg
tttgagaagatgtggacatacatgaagtcagcagagccatcagtttttgtgcggaccaca
gaggaggggatgattcgagtgaggaaatccaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacacccaaggggtctgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgattccaaggacaagacaagcgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttttgtttgatcccacagcaatccatcaacgaagccatacggacatcgaccctcccc
cgcaacagcggggcaggagccagcagcggcggcagtggagagaatggtcgggtggtcagc
catgacttccccaagtccatgcaatcgattccttgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

DBGET integrated database retrieval system