KEGG   Homo sapiens (human): 2891Help
Entry
2891              CDS       T01001                                 

Gene name
GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2
Definition
glutamate receptor, ionotropic, AMPA 2
Orthology
K05198  
glutamate receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Long-term depression
Amyotrophic lateral sclerosis (ALS)
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Drug target
Topiramate: 
Perampanel: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q32.1
AA seq 883 aa AA seqDB search
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagattatgcatatttctgtcctcctttctcctgttttatggggactgattttt
ggtgtctcttctaacagcatacagataggggggctatttcctaggggcgccgatcaagaa
tacagtgcatttcgagtagggatggttcagttttccacttcggagttcagactgacaccc
cacatcgacaatttggaggtggcaaacagcttcgcagtcactaatgctttctgctcccag
ttttcgagaggagtctatgctatttttggattttatgacaagaagtctgtaaataccatc
acatcattttgcggaacactccacgtctccttcatcactcccagcttcccaacagatggc
acacatccatttgtcattcagatgagacccgacctcaaaggagctctccttagcttgatt
gaatactatcaatgggacaagtttgcatacctctatgacagtgacagaggcttatcaaca
ctgcaagctgtgctggattctgctgctgaaaagaaatggcaagtgactgctatcaatgtg
ggaaacattaacaatgacaagaaagatgagatgtaccgatcactttttcaagatctggag
ttaaaaaaggaacggcgtgtaattctggactgtgaaagggataaagtaaacgacattgta
gaccaggttattaccattggaaaacatgttaaagggtaccactacatcattgcaaatctg
ggatttactgatggagacctattaaaaatccagtttggaggtgcaaatgtctctggattt
cagatagtggactatgatgattcgttggtatctaaatttatagaaagatggtcaacactg
gaagaaaaagaataccctggagctcacacaacaacaattaagtatacttctgctctgacc
tatgatgccgttcaagtgatgactgaagccttccgcaacctaaggaagcaaagaattgaa
atctcccgaagggggaatgcaggagactgtctggcaaacccagcagtgccctggggacaa
ggtgtagaaatagaaagggccctcaaacaggttcaggttgaaggtctctcaggaaatata
aagtttgaccagaatggaaaaagaataaactatacaattaacatcatggagctcaaaact
aatgggccccggaagattggctactggagtgaagtggacaaaatggttgttacccttact
gagctcccttctggaaatgacacctctgggcttgagaataagactgttgttgtcaccaca
attttggaatctccgtatgttatgatgaagaaaaatcatgaaatgcttgaaggcaatgag
cgctatgagggctactgtgttgacctggctgcagaaatcgccaaacattgtgggttcaag
tacaagttgacaattgttggtgatggcaagtatggggccagggatgcagacacgaaaatt
tggaatgggatggttggagaacttgtatatgggaaagctgatattgcaattgctccatta
actattacccttgtgagagaagaggtgattgacttctcaaagcccttcatgagcctcggg
atatctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcctttcttgat
cctttagcctatgagatctggatgtgcattgtttttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggagtttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcggcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctt
tctaagcaaacagaaattgcttatggaacattagactctggctccactaaagagtttttc
aggagatctaaaattgcagtgtttgataaaatgtggacctacatgcggagtgcggagccc
tctgtgtttgtgaggactacggccgaaggggtggctagagtgcggaagtccaaagggaaa
tatgcctacttgttggagtccacgatgaacgagtacattgagcaaaggaagccttgcgac
accatgaaagttggtggaaacctggattccaaaggctatggcatcgcaacacctaaagga
tcctcattaagaaccccagtaaatcttgcagtattgaaactcagtgagcaaggcgtctta
gacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggagccaaggactctgga
agtaaggaaaagaccagtgccctcagtctgagcaacgttgctggagtattctacatcctt
gtcgggggccttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaaggtggcaaagaatgcacagaatattaacccatcttcctcg
cagaattcacagaattttgcaacttataaggaaggttacaacgtatatggcatcgaaagt
gttaaaatttag

DBGET integrated database retrieval system