KEGG   Homo sapiens (human): 2893Help
Entry
2893              CDS       T01001                                 

Gene name
GRIA4, GLUR4, GLUR4C, GLURD, GluA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Drug target
Topiramate: 
Perampanel: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2893 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2893 (GRIA4)
   04728 Dopaminergic synapse
    2893 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    2893 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    2893 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    2893 (GRIA4)
   05033 Nicotine addiction
    2893 (GRIA4)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2893 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q22
AA seq 902 aa AA seqDB search
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttccagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgacagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagggaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctgaaa
agcacaggacctagaaaggttggttactggaatgatatggataagttagtcttgattcaa
gatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtagatttagtccatatgagtggcacacagaagagccagaggac
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacactggattcaggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtattcactaggactacagctgagggagtagctcgtgtccgcaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcctcattaggaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggagagaatggccgcgtcttgacgcctgactgcccaaag
gctgtacacactggaactgcaatcagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system