KEGG   Homo sapiens (human): 2893Help
Entry
2893              CDS       T01001                                 

Gene name
GRIA4, GLUR4, GLUR4C, GLURD, GluA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Drug target
Topiramate: 
Perampanel: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q22
AA seq 902 aa AA seqDB search
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttccagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgacagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagggaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctgaaa
agcacaggacctagaaaggttggttactggaatgatatggataagttagtcttgattcaa
gatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtagatttagtccatatgagtggcacacagaagagccagaggac
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacactggattcaggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtattcactaggactacagctgagggagtagctcgtgtccgcaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcctcattaggaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggagagaatggccgcgtcttgacgcctgactgcccaaag
gctgtacacactggaactgcaatcagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system