KEGG   Homo sapiens (human): 2894Help
Entry
2894              CDS       T01001                                 

Gene name
GRID1, GluD1
Definition
(RefSeq) glutamate ionotropic receptor delta type subunit 1
  KO
K05206  
glutamate receptor delta-1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2894 (GRID1)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2894 (GRID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22
AA seq 1009 aa AA seqDB search
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF
KYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS
VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPS
ASATLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSR
MDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADN
CVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPY
RDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIEL
SALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSAT
MPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgctgacgctgtggcttctcccctggatatgccagtgcgtgtcggtgcgggcc
gactccatcatccacatcggtgccatcttcgaggagaacgcggccaaggacgacagggtg
ttccagttggcggtatccgacctgagcctcaacgatgacatcctgcagagcgagaagatc
acctactccatcaaggtcatcgaggccaacaacccattccaggctgtgcaggaagcctgt
gacctcatgacccaggggattttggccttggtcacgtccactggctgtgcatctgccaat
gccctgcagtccctcacggatgccatgcacatcccacacctctttgtccagcgcaacccg
ggagggtcgccacgcaccgcatgccacctgaaccccagccccgatggtgaggcctacaca
ctggcttcgagaccacccgtccgcctcaatgatgtcatgctcaggctggtgacggagctg
cgctggcagaagttcgtcatgttctacgacagcgagtatgatatccgtgggcttcaaagc
tttctggaccaggcctcgcggctgggccttgacgtctctttacaaaaggtggacaagaac
attagccacgtattcaccagcctcttcaccacgatgaagacagaggagctgaatcgctac
cgggacacgcttcgccgcgccatcctgctgctcagcccacagggagcccactccttcatc
aacgaggccgtggagaccaacctggcttccaaggacagccactgggtctttgtgaatgag
gaaatcagtgacccggagatcctggatctggtccatagtgcccttggaaggatgaccgtg
gtccggcaaatctttccgtctgcaaaggacaatcagaaatgcacgaggaacaaccaccgc
atctcctccctgctctgcgacccccaggaaggctacctccagatgctgcagatctccaac
ctctatctgtatgacagtgttctgatgctggccaacgcctttcacaggaagctggaggac
cggaagtggcatagcatggcgagcctcaactgcatacggaaatccactaagccatggaat
ggtgggaggtccatgctggataccatcaaaaagggccacatcactggcctcactggggtg
atggagtttcgggaggacagttcgaatccctatgtccagtttgaaatccttggcactacc
tatagtgagacttttggcaaagacatgcgcaagttggcgacatgggactcagagaagggc
ttgaatggcagcttgcaagagaggcccatgggcagccgcctccaaggattgactcttaaa
gtggtgactgtcttggaagagcctttcgtgatggtggctgagaacatcctaggacagccc
aagcgctacaaagggttctccatagatgtcctggatgcactggccaaggctctgggcttt
aaatatgagatttaccaagcccctgatggcaggtacggtcaccagctccataacacctcc
tggaacgggatgatcggggagctcatcagcaagagagcagacttggccatctctgccatc
accatcaccccagagagggagagcgttgtggacttcagcaagcggtacatggactattca
gtggggattctaattaagaagcccgaggagaaaatcagcatcttctccctctttgctcca
tttgatttcgctgtgtgggcctgcattgcagcagccatccctgtggttggtgtgctgata
tttgtgttgaacaggatacaggctgtgagggctcagagtgctgcccagcccaggccgtca
gcttctgccactctgcacagcgccatctggattgtctatggagccttcgtacagcaaggt
ggcgaatcttccgtgaactccatggccatgcgcatcgtgatgggcagctggtggctcttc
acgctcattgtgtgctcctcctacacagccaaccttgctgccttcctcacagtgtccagg
atggacaaccccataaggactttccaggacctgtccaaacaagtggaaatgtcttatggc
actgtccgggattctgctgtatatgagtacttccgagccaagggcaccaaccccctggag
caggacagcacgtttgctgaactctggcggaccatcagcaagaacggaggggctgacaac
tgcgtgtccagtccttcagaaggcatcaggaaggcaaagaaggggaactacgccttcctg
tgggatgtggccgtggtggaatacgcagccctgacggatgacgactgctcggtgactgtc
atcggcaacagcatcagcagcaagggttacgggattgccctgcagcatggcagcccctac
agggacctcttctcccagaggatcctggagctgcaggacacaggggacctggatgtgctg
aagcagaagtggtggccgcacatgggccgctgtgacctcaccagccatgccagcgcccag
gccgacggcaaatccctcaagctgcacagcttcgccggggtcttctgcatcctggccatt
ggcctgctcctggcctgcctggtggctgccctggagttgtggtggaacagcaaccggtgc
caccaggagacccccaaggaggacaaagaagtgaacttggagcaggtccaccggcgcatg
aacagcctcatggatgaagacattgctcacaagcagatttccccagcgtcgattgagctc
tcggccctggagatggggggcctggctcccacccagaccttggagccgacacgggagtac
cagaacacccagctctcggtcagcacctttctgccagagcagagcagccatggcaccagc
cggacactctcatcagggcccagcagcaacctgccgctgccgctgagcagctcggcgacc
atgccctccatgcagtgcaaacacaggtcacccaacggggggctgttccggcagagcccg
gtgaagacccccatccccatgtccttccagcccgtgcctggaggcgtccttccagaggct
ctggacacctcccacgggacctccatctga

DBGET integrated database retrieval system