KEGG   Homo sapiens (human): 2895Help
Entry
2895              CDS       T01001                                 

Gene name
GRID2, GluD2, SCAR18
Definition
(RefSeq) glutamate ionotropic receptor delta type subunit 2
  KO
K05207  
glutamate receptor delta-2 subunit
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Long-term depression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2895 (GRID2)
 Organismal Systems
  Nervous system
   04730 Long-term depression
    2895 (GRID2)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2895 (GRID2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22
AA seq 1007 aa AA seqDB search
MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPY
RDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAA
GIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atggaagttttcccctttctcttggttttgtccgtctggtggtctcgaacctgggactcg
gcgaatgcggattcgatcattcacatcggagcaatttttgatgaatctgccaaaaaggat
gatgaggtatttcgcactgcggttggtgaccttaaccagaatgaggagatcttacagact
gagaaaatcacattttcagtgacgtttgttgatggcaacaaccctttccaagcagttcaa
gaagcctgtgaacttatgaatcaaggcatcttggccctggtcagctccattggctgcacg
tcagcaggatccctccagtctttggcagacgccatgcatatcccccacctcttcattcag
cgctcaacagctgggaccccaaggagtggctgtggactcacccggagcaacaggaatgat
gactacactctctcagttcgcccacctgtctacttgcatgatgttatcctaagagtggtc
acagagtatgcctggcagaaattcattatattctatgatagtgaatacgatatccgtgga
atacaggagttcttggacaaagtctctcagcagggaatggatgttgcacttcagaaggta
gaaaacaacatcaataaaatgattaccactctctttgacaccatgagaatagaagaactg
aatcgctatcgagacactcttaggcgagcgatccttgttatgaatcctgctacagccaaa
tccttcattactgaggttgtggagactaatttggttgcttttgactgtcactggatcatt
ataaatgaggaaataaacgatgtggacgtacaggaacttgtaagaaggtcaattggaagg
ttaacgattattcggcagacatttccagttccccagaacataagtcagcggtgtttccgt
ggcaaccatcgaatatcttcaacattgtgtgatccaaaggatccatttgctcagaatatg
gagatttccaacctttacatatatgacacggtgcttctgcttgctaatgcttttcataag
aagctggaggaccgaaagtggcacagcatggcaagtctgtcatgtatcagaaagaactca
aagccctggcagggtgggcgctccatgttggagaccatcaagaagggtggagttagtggg
ttgactggagagctagaatttggagaaaatggaggcaatcccaatgtccactttgaaatc
cttggaaccaactatggagaagagcttggcagaggtgttcgaaaacttggttgctggaat
cctgtcacaggtctgaatgggtcactgactgacaagaaattggagaataacatgcgtgga
gtggttctacgtgtagtaactgttctggaagaaccttttgtgatggtctctgaaaatgtc
ttgggtaagccgaagaaataccagggcttctccattgatgttttggatgccttatctaac
tacctgggttttaactacgaaatttacgtagcaccggatcacaaatacggaagcccacaa
gaagatgggacatggaatggcttggtaggagaacttgtctttaagagagccgacataggg
atttctgctttaaccatcactccagatcgtgaaaatgtggtggactttacgacacgttac
atggactactcagtgggggtactacttcgaagggctgaaaagacagtggatatgtttgcc
tgtcttgcaccatttgatctctctctatgggcttgcattgctggcacagtccttctggtg
ggtctactggtctacctcttgaactggcttaatcccccacgattacaaatgggatcaatg
acgtctactactctctacaactccatgtggtttgtgtatggatcttttgtacaacaaggc
ggggaagtcccgtacacgactctggctacccgaatgatgatgggggcttggtggctattt
gctttgattgttatctcatcttacacggcaaacctcgctgctttcctcactattacacgc
attgaaagttccatccagtctctccaggacctttccaagcaaacagaaatcccttatggc
acagtcctagactctgcggtatatgagcatgtccgcatgaaaggactgaatccttttgag
agggacagcatgtattcccaaatgtggcggatgatcaaccgaagcaatggatcggagaac
aatgttctggagtcccaggcaggcattcaaaaggtaaaatatggaaattatgctttcgta
tgggatgcagctgtattggaatatgtggctatcaatgacccagattgttccttttacacc
attggaaatactgttgctgatcggggatatggaattgcattacaacatggcagtccttac
cgagatgttttttcacaaaggatcctggagcttcagcagaatggtgacatggacatcctg
aagcacaaatggtggcctaagaatggccagtgtgacctgtactcgtcagtggacacaaag
cagaaaggaggcgccctggacataaagagctttgcaggggtcttttgtatcctggctgct
ggaattgtcctctcctgcttcatagccatgctggagacgtggtggaacaagaggaaaggc
tcccgggttccatcaaaagaggatgacaaggaaattgacctggagcacctccatagacgt
gtaaatagcttgtgcacagatgacgacagcccccataaacagttttccacctcgtcaatt
gatttgacccctctggacattgacactttgccaacacgacaagcactggagcaaatcagt
gatttcaggaacactcatattaccacaacaacctttatcccagagcagatccagactctt
agccgcacactgtcagctaaagctgcttctggtttcacttttggcaacgtgcctgagcac
cgaactggcccttttaggcacagggcacctaatgggggctttttcaggagtcctataaaa
acaatgtcatctattccttatcaaccaactcctaccctggggctcaatctgggtaatgat
ccagaccgaggcacctccatatga

DBGET integrated database retrieval system