KEGG   Homo sapiens (human): 28957Help
Entry
28957             CDS       T01001                                 

Gene name
MRPS28, HSPC007, MRP-S28, MRP-S35, MRPS35
Definition
(RefSeq) mitochondrial ribosomal protein S28
  KO
K17407  
small subunit ribosomal protein S28
Organism
hsa  Homo sapiens (human)
Brite
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    28957 (MRPS28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y2Q9(Tdark)
UniProt: 
Position
8q21.13
AA seq 187 aa AA seqDB search
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHS
ELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKF
HCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRS
KEEHHEK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgtgtcggacccgtgctgtggctgccgagagccattttctgcgagtgttt
ctcttcttcaggccctttcggggtgtaggcactgagagtggatccgaaagtggtagttcc
aatgccaaggagcctaagacgcgcgcaggcggtttcgcgagcgcgttggagcggcactcg
gagcttctacagaaggtggagcccctacagaagggttctccaaaaaatgtggaatccttt
gcatctatgctgagacattctcctcttacacagatgggacctgcaaaggataaactggtc
attggacggatctttcatattgtggagaatgatctgtacatagattttggtggaaagttt
cattgtgtatgtagaagaccagaagtggatggagagaaataccagaaaggaaccagggtc
cggttgcggctattagatcttgaacttacgtctaggttcctgggagcaacaacagataca
actgtactagaggctaatgcagttctcttgggaatccaggagagtaaagactcaagatcg
aaagaagaacatcatgaaaaataa

DBGET integrated database retrieval system