KEGG   Homo sapiens (human): 28957Help
Entry
28957             CDS       T01001                                 

Gene name
MRPS28, HSPC007, MRP-S28, MRP-S35, MRPS35
Definition
(RefSeq) mitochondrial ribosomal protein S28
  KO
K17407  small subunit ribosomal protein S28
Organism
hsa  Homo sapiens (human)
Brite
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    28957 (MRPS28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP-S35 S1
Motif
Other DBs
NCBI-GeneID: 28957
NCBI-ProteinID: NP_054737
OMIM: 611990
HGNC: 14513
Ensembl: ENSG00000147586
Vega: OTTHUMG00000164642
Pharos: Q9Y2Q9(Tdark)
UniProt: Q9Y2Q9 A0A0S2Z563
Position
8q21.13
AA seq 187 aa AA seqDB search
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHS
ELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKF
HCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRS
KEEHHEK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgtgtcggacccgtgctgtggctgccgagagccattttctgcgagtgttt
ctcttcttcaggccctttcggggtgtaggcactgagagtggatccgaaagtggtagttcc
aatgccaaggagcctaagacgcgcgcaggcggtttcgcgagcgcgttggagcggcactcg
gagcttctacagaaggtggagcccctacagaagggttctccaaaaaatgtggaatccttt
gcatctatgctgagacattctcctcttacacagatgggacctgcaaaggataaactggtc
attggacggatctttcatattgtggagaatgatctgtacatagattttggtggaaagttt
cattgtgtatgtagaagaccagaagtggatggagagaaataccagaaaggaaccagggtc
cggttgcggctattagatcttgaacttacgtctaggttcctgggagcaacaacagataca
actgtactagaggctaatgcagttctcttgggaatccaggagagtaaagactcaagatcg
aaagaagaacatcatgaaaaataa

DBGET integrated database retrieval system