KEGG   Homo sapiens (human): 28964Help
Entry
28964             CDS       T01001                                 

Gene name
GIT1
Definition
G protein-coupled receptor kinase interacting ArfGAP 1
Orthology
K05737  
G protein-coupled receptor kinase interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Regulation of actin cytoskeleton
Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    28964 (GIT1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    28964 (GIT1)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    28964 (GIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 770 aa AA seqDB search
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADRSRQKCMSQSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRE
NDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEA
KRRQQGKSLSSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSM
DSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQL
RQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRL
QPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHG
SGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQ
VTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYR
LQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaaaggggccgcgagcggaggtgtgtgcggactgcagcgccccggaccctggc
tgggcatccatcagcaggggtgtgctggtgtgtgacgagtgctgcagcgtgcaccggagc
ctgggacgccacatctccattgtcaagcaccttcgccacagcgcctggcctcccacgctg
ctgcagatggtgcacacgcttgccagcaacggggccaactccatctgggagcactccctg
ctggaccccgcacaagtgcagagcggccggcgtaaagccaacccccaagacaaagtccac
cccatcaagtcagagttcatcagggccaagtaccagatgctggcatttgtgcacaagctt
ccctgccgggacgatgatggagtcaccgccaaagacctcagcaagcaactacactcgagc
gtgcggacaggcaacctggagacatgtctgcgcctgctctccctgggtgcccaggccaac
ttcttccacccagagaagggcaccacacctctgcacgtggctgccaaggcaggacagaca
ctgcaggccgagctgcttgtagtgtatggggctgaccctggctcccctgatgttaatggc
cgcacacccattgactatgccaggcaggcggggcaccatgagctggcggaaaggctggtt
gagtgccaatatgagctcactgaccggctggccttctacctctgtggacgcaagccggat
cacaagaatgggcattacatcatcccacagatggctgacagatctcggcaaaagtgcatg
tctcagagccttgacttatccgaattggccaaagctgctaagaagaagctgcaggcgctc
agcaaccggctttttgaggaactcgccatggacgtgtatgacgaggtggatcgaagagaa
aatgatgcagtgtggctggctacccaaaaccacagcactctggtgacagagcgcagtgcc
gtgcccttcctgcctgttaacccggaatactcagccacgcggaatcaggggcgacaaaag
ctggcccgctttaatgcccgagagtttgccaccttgatcatcgacattctcagtgaggcc
aagcggagacagcagggcaagagcctgagcagccccacagacaacctcgagctgtctctg
cggagccagagtgacctcgacgaccaacacgactacgacagcgtggcctctgacgaggac
acagaccaggagcccctgcgcagcaccggcgccactcggagcaaccgggcccggagcatg
gactcctcggacttgtctgacggggctgtgacgctgcaggagtacctggagctgaagaag
gccctggctacatcggaggcaaaggtgcagcagctcatgaaggtcaacagtagcctgagc
gacgagctccggaggctgcagcgagagatccacaagctgcaggcggagaacctgcagctc
cggcagcctccagggccggtgcccacacctccactccccagtgaacgggcggaacacaca
cccatggcgccaggcgggagcacacaccgcagggatcgccaggccttttccatgtatgaa
cctggctctgccctgaagccctttgggggcccccctggggacgagctcactacgcggctg
cagcctttccacagcactgagctagaggacgacgccatctattcagtgcacgtccctgct
ggcctttaccggatccggaaaggggtgtctgcctcagctgtgcccttcactccctcctcc
ccgctgctgtcctgctcccaggagggaagccgccacacgagcaagctttcccgccacggc
agtggagccgacagtgactatgagaacacgcaaagtggggacccactgctggggctggaa
gggaagaggtttctagagctgggcaaagaggaagacttccacccagagctggaaagcctg
gatggagacctagatcctgggcttcccagcacagaggatgtcatcttgaagacagagcag
gtcaccaagaacattcaggaactgttgcgggcagcccaggagttcaagcatgacagcttc
gtgccctgctcagagaagatccatttggctgtgaccgagatggcctccctcttcccaaag
aggccagccctggagccagtgcggagctcactgcggctgctcaacgccagcgcctaccgg
ctgcagagtgagtgccggaagacagtgcccccagagcccggcgccccagtggacttccag
ctgctgactcagcaggtgatccagtgcgcctatgacatcgccaaggctgccaagcagctg
gtcaccatcaccacccgagagaagaagcagtga

DBGET integrated database retrieval system