KEGG   Homo sapiens (human): 28965Help
Entry
28965             CDS       T01001                                 

Gene name
SLC27A6, ACSVL2, FACVL2, FATP6, VLCS-H1
Definition
solute carrier family 27 (fatty acid transporter), member 6
Orthology
K08749  
solute carrier family 27 (fatty acid transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    28965 (SLC27A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q23.3
AA seq 619 aa AA seqDB search
MLLSWLTVLGAGMVVLHFLQKLLFPYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKF
LSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVH
VWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVW
GMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQ
VLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDC
KKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCEL
YAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE
PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRT
GDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEK
VYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKS
YVLLTRELYDQIMLGEIKL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgtcatggctaacagttctaggggctggaatggtcgtcctgcacttcttgcag
aaactcctgttcccttacttttgggatgacttctggttcgtgttgaaggtggtgctcatt
ataattcggctgaagaagtatgaaaagagaggggagctggtgactgtgctggataaattc
ttgagtcatgccaaaagacaacctcggaaacctttcatcatctatgagggagacatctac
acctatcaggatgtagacaaaaggagcagcagagtggcccatgtcttcctgaaccattcc
tctctgaaaaagggggacacggtggctctgctgatgagcaatgagccggacttcgttcac
gtgtggttcggcctcgccaagctgggctgcgtggtggcctttctcaacaccaacattcgc
tccaactccctcctgaattgcatccgcgcctgtgggcccagagccctagtggtgggcgca
gatttgcttggaacggtagaagaaatccttccaagcctctcagaaaatatcagtgtttgg
gggatgaaagattctgttccacaaggtgtaatttcactcaaagaaaaactgagcacctca
cctgatgagcccgtgccacgcagccaccatgttgtctcactcctcaagtctacttgtctt
tacatttttacctctggaacaacaggtctaccaaaagcagctgtgattagtcagctgcag
gttttaaggggttctgctgtcctgtgggcttttggttgtactgctcatgacattgtttat
ataacccttcctctgtatcatagttcagcagctatcctgggaatttctggatgtgttgag
ttgggtgccacttgtgtgttaaagaagaaattttcagcaagccagttttggagtgactgc
aagaagtatgatgtgactgtgtttcagtatattggagaactttgtcgctacctttgcaaa
caatctaagagagaaggagaaaaggatcataaggtgcgtttggcaattggaaatggcata
cggagtgatgtatggagagaatttttagacagatttggaaatataaaggtgtgtgaactt
tatgcagctaccgaatcaagcatatctttcatgaactacactgggagaattggagcaatt
gggagaacaaatttgttttacaaacttctttccacttttgacttaataaagtatgacttt
cagaaagatgaacccatgagaaatgagcagggttggtgtattcatgtgaaaaaaggagaa
cctggacttctcatttctcgagtgaatgcaaaaaatcccttctttggctatgctgggcct
tataagcacacaaaagacaaattgctttgtgatgtttttaagaagggagatgtttacctt
aatactggagacttaatagtccaggatcaggacaatttcctttatttttgggaccgtact
ggagacactttcagatggaaaggagaaaatgtcgcaaccactgaggttgctgatgttatt
ggaatgttggatttcatacaggaagcaaacgtctatggtgtggctatatcaggttatgaa
ggaagagcaggaatggcttctattattttaaaaccaaatacatctttagatttggaaaaa
gtttatgaacaagttgtaacatttctaccagcttatgcttgtccacgatttttaagaatt
caggaaaaaatggaagcaacaggaacattcaaactattgaagcatcagttggtggaagat
ggatttaatccactgaaaatttctgaaccactttacttcatggataacttgaaaaagtct
tatgttctactgaccagggaactttatgatcaaataatgttaggggaaataaaactttaa

DBGET integrated database retrieval system