KEGG   Homo sapiens (human): 2897Help
Entry
2897              CDS       T01001                                 

Gene name
GRIK1, EAA3, EEA3, GLR5, GLUR5, GluK1
Definition
glutamate receptor, ionotropic, kainate 1
Orthology
K05201  
glutamate receptor, ionotropic kainate 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Drug target
Topiramate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2897 (GRIK1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2897 (GRIK1)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2897 (GRIK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 918 aa AA seqDB search
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggagcacggcacactcctcgcccagcccgggctctggaccagggacaccagctgggca
ctcctctatttcctctgctatatcctccctcagaccgccccgcaagtactcaggatcgga
gggatttttgaaacagtggaaaatgagcctgttaatgttgaagaattagctttcaagttt
gcagtcaccagcattaacagaaaccgaaccctgatgcctaacaccacattaacctatgac
atccagagaattaacctttttgatagttttgaagcctcgcggagagcatgtgaccagctg
gctcttggtgtggctgctctctttggcccttcccatagctcctccgtcagtgctgtgcag
tctatttgcaatgctctcgaagttccacacatacagacccgctggaaacacccctcggtg
gacaacaaagatttgttttacatcaacctttacccagattatgcagctatcagcagggcg
atcctggatctggtcctctattacaactggaaaacagtgacagtggtgtatgaagacagc
acaggtctaattcgtctacaagagctcatcaaagctccctccagatataatattaaaatc
aaaatccgccagctgccctctgggaataaagatgccaagcctttactcaaggagatgaag
aaaggcaaggagttctatgtgatatttgattgttcacatgaaacagccgctgaaatcctt
aagcagattctgttcatgggcatgatgaccgagtactatcactactttttcacaaccctg
gacttatttgctttggatctggaactctataggtacagtggcgtaaacatgaccgggttt
cggctgcttaacattgacaaccctcacgtgtcatccatcattgagaagtggtccatggag
agactgcaggccccacccaggcccgagactggccttttggatggcatgatgacaactgaa
gcggctctgatgtacgatgctgtgtacatggtggccattgcctcgcaccgggcatcccag
ctgaccgtcagctccctgcagtgccatagacataagccatggcgcctcggacccagattt
atgaacctgatcaaagaggcccggtgggatggcttgactgggcatatcacctttaataaa
accaatggcttgaggaaggattttgatctggacattattagtctcaaagaggaaggaact
gaaaaggctgctggcgaagtgtctaaacacttgtataaagtgtggaagaagattgggatt
tggaattccaacagtgggcttaacatgacggacagcaacaaagacaagtccagcaatatc
actgattcattggccaacagaacactcattgtcaccaccattctggaagaaccctatgtt
atgtacaggaaatctgataagcctctatatggaaatgacagatttgaaggatattgccta
gacctgttgaaagaattgtcaaacatcctgggtttcatttatgatgttaaactagttccc
gatggcaaatatggggcccagaatgacaaaggggagtggaacgggatggttaaagaactc
atagatcacagggctgacctggcagtggctcctcttaccatcacctacgtgcgggagaaa
gtcattgacttctccaaacccttcatgaccctaggcatcagcattctctaccggaagccc
aatggtaccaatccaggcgttttctccttcctcaaccccctgtctccagatatttggatg
tatgtgctcttagcctgcttgggagtcagctgtgtactctttgtgattgcaaggtttaca
ccctacgagtggtataacccccacccatgcaaccctgactcagacgtggtggaaaacaat
tttactttactaaatagtttctggtttggagttggagctctcatgcagcaaggatcagag
ctgatgcccaaagctctatcgaccagaatagttggagggatatggtggtttttcacccta
atcatcatttcatcctacacggccaatctggctgccttcttgacagtagagagaatggaa
tcccccatagattcggcagatgatctggcaaagcaaaccaagatagaatatggggcggtt
agagatggatcaacaatgaccttcttcaagaaatcaaaaatctccacctatgagaagatg
tgggctttcatgagcagcaggcagcagaccgccctggtaagaaacagtgatgaggggatc
cagagagtgctcaccacagactacgcgctgctgatggagtccaccagcattgagtatgtg
acgcagagaaactgcaacctcactcagatcgggggcctcattgactccaaaggttacgga
gtgggaacacctattggttctccttaccgggataaaattactattgctattcttcaactc
caagaagaagggaagctgcatatgatgaaagagaagtggtggcgtgggaatggctgcccc
gaggaagacaacaaagaagccagtgccctgggagtggaaaatattggaggcatcttcatt
gttctggctgccggactggtcctttctgtatttgtagctattggagaattcatatacaaa
tcacggaagaataatgatattgaacaggctttttgtttcttttatggactgcaatgtaag
caaacccatccaaccaactccacttctggaactactttatctacggatttagaatgtggt
aaattaattcgagaggagagagggattcgaaaacagtcctcagttcatactgtgtaa

DBGET integrated database retrieval system