KEGG   Homo sapiens (human): 28973Help
Entry
28973             CDS       T01001                                 

Gene name
MRPS18B, C6orf14, HSPC183, HumanS18a, MRP-S18-2, MRPS18-2, PTD017, S18amt
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    28973 (MRPS18B)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    28973 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 258 aa AA seqDB search
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgtattaaacaccgtgctgaggcggcttcctatgctatctctcttccga
ggttctcacagagttcaggttcccctccagactctttgcaccaaagctccctctgaggaa
gattctttgtcctcagttcccatttctccttataaggatgagccctggaaatatctggaa
tcagaagaataccaggagcgatatggttctcgccccgtctgggctgactaccgccgcaac
cacaagggtggtgtacccccacagcggactcggaagacatgtattcgtcggaataaagtt
gttgggaatccctgccccatctgtcgagatcacaagttgcatgttgactttaggaacgtg
aagctcttggagcaatttgtctgcgcccacacgggtatcatcttctatgctccatacaca
ggagtctgtgtgaagcagcacaagcggttgacccaggccatccagaaagccagggatcat
ggtctcctcatttaccacatcccccaggttgaaccacgggaccttgacttcagtacctct
catggggctgtgagtgctactccgccagcccccaccctggtctcaggtgacccctggtac
ccatggtacaactggaaacagccaccggagagagaactgtctcgccttcgccggctttac
cagggtcatctccaagaagagagtggccccccacctgagtcaatgcccaagatgccccct
agaacaccagcggaagcctcctccactgggcagacaggccctcagagtgctctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system