KEGG   Homo sapiens (human): 2898Help
Entry
2898              CDS       T01001                                 

Gene name
GRIK2, EAA4, GLR6, GLUK6, GLUR6, GluK2, MRT6
Definition
glutamate receptor, ionotropic, kainate 2
Orthology
K05202  
glutamate receptor, ionotropic kainate 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Disease
H00768  
Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
Drug target
Topiramate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2898 (GRIK2)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2898 (GRIK2)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2898 (GRIK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q16.3
AA seq 892 aa AA seqDB search
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRAKTKLPQDYVFLPILESVSISTVLSSSPSSSSLSSCS
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgaagattattttcccgattctaagtaatccagtcttcaggcgcaccgttaaactcctg
ctctgtttactgtggattggatattctcaaggaaccacacatgtattaagatttggtggt
atttttgaatatgtggaatctggcccaatgggagctgaggaacttgcattcagatttgct
gtgaacacaattaacagaaacagaacattgctacccaatactacccttacctatgatacc
cagaagataaacctttatgatagttttgaagcatccaagaaagcctgtgatcagctgtct
cttggggtggctgccatcttcgggccttcacacagctcatcagcaaacgcagtgcagtcc
atctgcaatgctctgggagttccccacatacagacccgctggaagcaccaggtgtcagac
aacaaagattccttctatgtcagtctctacccagacttctcttcactcagccgtgccatt
ttagacctggtgcagtttttcaagtggaaaaccgtcacggttgtgtatgatgacagcact
ggtctcattcgtttgcaagagctcatcaaagctccatcaaggtataatcttcgactcaaa
attcgtcagttacctgctgatacaaaggatgcaaaacccttactaaaagaaatgaaaaga
ggcaaggagtttcatgtaatctttgattgtagccatgaaatggcagcaggcattttaaaa
caggcattagctatgggaatgatgacagaatactatcattatatctttaccactctggac
ctctttgctcttgatgttgagccctaccgatacagtggtgttaacatgacagggttcaga
atattaaatacagaaaatacccaagtctcctccatcattgaaaagtggtcgatggaacga
ttgcaggcacctccgaaacccgattcaggtttgctggatggatttatgacgactgatgct
gctctaatgtatgatgctgtgcatgtggtgtctgtggccgttcaacagtttccccagatg
acagtcagttccttgcagtgtaatcgacataaaccctggcgcttcgggacccgctttatg
agtctaattaaagaggcacattgggaaggcctcacaggcagaataactttcaacaaaacc
aatggcttgagaacagattttgatttggatgtgatcagtctgaaggaagaaggtctagaa
aagattggaacgtgggatccagccagtggcctgaatatgacagaaagtcaaaagggaaag
ccagcgaacatcacagattccttatccaatcgttctttgattgttaccaccattttggaa
gagccttatgtcctttttaagaagtctgacaaacctctctatggtaatgatcgatttgaa
ggctattgcattgatctcctcagagagttatctacaatccttggctttacatatgaaatt
agacttgtggaagatgggaaatatggagcccaggatgatgccaatggacaatggaatgga
atggttcgtgaactaattgatcataaagctgaccttgcagttgctccactggctattacc
tatgttcgagagaaggtcatcgacttttccaagccctttatgacacttggaataagtatt
ttgtaccgcaagcccaatggtacaaacccaggcgtcttctccttcctgaatcctctctcc
cctgatatctggatgtatattctgctggcttacttgggtgtcagttgtgtgctctttgtc
atagccaggtttagtccttatgagtggtataatccacacccttgcaaccctgactcagac
gtggtggaaaacaattttaccttgctaaatagtttctggtttggagttggagctctcatg
cagcaaggttctgagctcatgcccaaagcactgtccaccaggatagtgggaggcatttgg
tggtttttcacacttatcatcatttcttcgtatactgctaacttagccgcctttctgaca
gtggaacgcatggaatcccctattgactctgctgatgatttagctaaacaaaccaagata
gaatatggagcagtagaggatggtgcaaccatgacttttttcaagaaatcaaaaatctcc
acgtatgacaaaatgtgggcctttatgagtagcagaaggcagtcagtgctggtcaaaagt
aatgaagaaggaatccagcgagtcctcacctctgattatgctttcctaatggagtcaaca
accatcgagtttgttacccagcggaactgtaacctgacacagattggcggccttatagac
tctaaaggttatggcgttggcactcccatgggttctccatatcgagacaaaattaccata
gcaattcttcagctgcaagaggaaggcaaactgcatatgatgaaggagaaatggtggagg
ggcaatggttgcccagaagaggagagcaaagaggccagtgccctgggggttcagaatatt
ggtggcatcttcattgttctggcagccggcttggtgctttcagtttttgtggcagtggga
gaatttttatacaaatccaaaaaaaacgctcaattggaaaagagagccaagactaagtta
cctcaagactatgtattcctccctattttggagtcagtttccatttctacagtgttgtca
tcatcaccatcttcatcatcattatcatcatgttcttaa

DBGET integrated database retrieval system