KEGG   Homo sapiens (human): 28982Help
Entry
28982             CDS       T01001                                 

Gene name
FLVCR1, AXPC1, FLVCR, MFSD7B, PCA, PCARP
Definition
(RefSeq) feline leukemia virus subgroup C cellular receptor 1
  KO
K08220  
MFS transporter, FLVCR family, feline leukemia virus subgroup C receptor-related protein
Organism
hsa  Homo sapiens (human)
Disease
H01036  
Posterior column ataxia with retinitis pigmentosa (PCARP)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC49: Transporters of the major facilitator superfamily
   28982 (FLVCR1)
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Feline leukemia virus subgroup C receptor (FLVCR) [TC:2.A.1.28]
    28982 (FLVCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.3
AA seq 555 aa AA seqDB search
MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAA
SGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRRFVVLLIFSLYSLV
NAFQWIQYSIISNVFEGFYGVTLLHIDWLSMVYMLAYVPLIFPATWLLDTRGLRLTALLG
SGLNCLGAWIKCGSVQQHLFWVTMLGQCLCSVAQVFILGLPSRIASVWFGPKEVSTACAT
AVLGNQLGTAVGFLLPPVLVPNTQNDTNLLACNISTMFYGTSAVATLLFILTAIAFKEKP
RYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYSVSTLLNQMIL
TYYEGEEVNAGRIGLTLVVAGMVGSILCGLWLDYTKTYKQTTLIVYILSFIGMVIFTFTL
DLRYIIIVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTLA
QGKLTSDYGPKAGNIFLCVWMFIGIILTALIKSDLRRHNINIGITNVDVKAIPADSPTDQ
EPKTVMLSKQSESAI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggccagacgatgaggagggggcggcggtggcgcccggacacccgctcgcgaaa
ggatacctcccgttgccgaggggcgcgcccgttgggaaggagagcgtggagctgcagaac
gggcccaaagcgggcaccttcccggtgaatggggccccccgggacagcctcgctgccgcc
tcgggagttctgggcgggcctcagactccactggccccagaagaggagacccaggcccgg
ctgctgcctgcgggcgcgggagctgagaccccgggggccgagagcagcccgctgcccctt
acggcgctctccccgcggcgcttcgtggtgctcctgatcttcagcctgtactcgctggtc
aacgcctttcagtggatccagtacagcatcattagcaacgtcttcgagggcttctacggt
gtcaccttgctgcacatcgactggctgtccatggtgtacatgctggcctacgtgcccctc
atcttcccggccacctggctgctggacaccagaggcctgcggctcaccgccctgctgggc
tccggcctcaactgcctgggtgcctggatcaagtgcggcagtgtgcagcagcatctcttc
tgggtcaccatgttgggccagtgcttgtgctcggtggcccaggtgttcatcctgggcttg
ccctcccgcatcgcctcagtgtggtttgggcccaaagaggtgtccacagcttgtgccacc
gccgtgctgggcaatcagcttggaactgcagttggctttttgctaccaccagttttagta
cccaacacacagaatgacacaaatctcctggcttgtaatatcagcaccatgttttatgga
acatcagctgttgccacacttttatttattttaacagcaattgccttcaaagaaaaacct
cggtatccaccaagtcaggctcaagcagctcttcaagacagtccccctgaagagtactcc
tataagaaatcaataagaaacctgtttaaaaacattccttttgtccttctgttgatcact
tatggtatcatgactggtgccttttattcagtctcaacgttattaaatcaaatgatattg
acatattatgagggagaagaagtcaatgctggaaggattgggctaacgctagtagtagct
ggaatggtgggctctattctttgtggcttatggctggattatactaaaacatacaaacag
actactctgatagtttatattttgtcttttattggaatggttatctttactttcacattg
gaccttagatatattatcatcgtgtttgttactggaggggtgcttggcttcttcatgact
ggttacctccctttgggttttgaatttgctgttgaaatcacttaccctgaatctgaaggt
acttcatctggtcttcttaatgcttctgcacagatatttggaattttgttcacattggct
caaggaaagctcacatcagactatggtcctaaggcagggaacatttttctctgtgtctgg
atgtttataggcatcatattaacagcattaatcaagtctgatctgcgaagacacaacata
aatataggaattacaaatgttgatgttaaagctataccagctgacagtcccacagaccaa
gaaccaaaaacggttatgttgtccaagcagtcagaatcagcaatttga

DBGET integrated database retrieval system