KEGG   Homo sapiens (human): 290Help
Entry
290               CDS       T01001                                 

Gene name
ANPEP, APN, CD13, GP150, LAP1, P150, PEPN
Definition
alanyl (membrane) aminopeptidase (EC:3.4.11.2)
Orthology
K11140  
aminopeptidase N [EC:3.4.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolic pathways
Renin-angiotensin system
Hematopoietic cell lineage
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    290 (ANPEP)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    290 (ANPEP)
  Endocrine system
   04614 Renin-angiotensin system
    290 (ANPEP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     290 (ANPEP)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M1
   290 (ANPEP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   290 (ANPEP)
Cellular antigens [BR:hsa04090]
 Proteins
  290 (ANPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q25-q26
AA seq 967 aa AA seqDB search
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggcttctatatttccaagtccctgggcatcctggggatcctcctgggcgtg
gcagccgtgtgcacaatcatcgcactgtcagtggtgtactcccaggagaagaacaagaac
gccaacagctcccccgtggcctccaccaccccgtccgcctcagccaccaccaaccccgcc
tcggccaccaccttggaccaaagtaaagcgtggaatcgttaccgcctccccaacacgctg
aaacccgattcctaccgggtgacgctgagaccgtacctcacccccaatgacaggggcctg
tacgtttttaagggctccagcaccgtccgtttcacctgcaaggaggccactgacgtcatc
atcatccacagcaagaagctcaactacaccctcagccaggggcacagggtggtcctgcgt
ggtgtgggaggctcccagccccccgacattgacaagactgagctggtggagcccaccgag
tacctggtggtgcacctcaagggctccctggtgaaggacagccagtatgagatggacagc
gagttcgagggggagttggcagatgacctggcgggcttctaccgcagcgagtacatggag
ggcaatgtcagaaaggtggtggccactacacagatgcaggctgcagatgcccggaagtcc
ttcccatgcttcgatgagccggccatgaaggccgagttcaacatcacgcttatccacccc
aaggacctgacagccctgtccaacatgcttcccaaaggtcccagcaccccacttccagaa
gaccccaactggaatgtcactgagttccacaccacgcccaagatgtccacgtacttgctg
gccttcattgtcagtgagttcgactacgtggagaagcaggcatccaatggtgtcttgatc
cggatctgggcccggcccagtgccattgcggcgggccacggcgattatgccctgaacgtg
acgggccccatccttaacttctttgctggtcattatgacacaccctacccactcccaaaa
tcagaccagattggcctgccagacttcaacgccggcgccatggagaactggggactggtg
acctaccgggagaactccctgctgttcgaccccctgtcctcctccagcagcaacaaggag
cgggtggtcactgtgattgctcatgagctggcccaccagtggttcgggaacctggtgacc
atagagtggtggaatgacctgtggctgaacgagggcttcgcctcctacgtggagtacctg
ggtgctgactatgcggagcccacctggaacttgaaagacctcatggtgctgaatgatgtg
taccgcgtgatggcagtggatgcactggcctcctcccacccgctgtccacacccgcctcg
gagatcaacacgccggcccagatcagtgagctgtttgacgccatctcctacagcaagggc
gcctcagtcctcaggatgctctccagcttcctgtccgaggacgtattcaagcagggcctg
gcgtcctacctccacacctttgcctaccagaacaccatctacctgaacctgtgggaccac
ctgcaggaggctgtgaacaaccggtccatccaactccccaccaccgtgcgggacatcatg
aaccgctggaccctgcagatgggcttcccggtcatcacggtggataccagcacggggacc
ctttcccaggagcacttcctccttgaccccgattccaatgttacccgcccctcagaattc
aactacgtgtggattgtgcccatcacatccatcagagatggcagacagcagcaggactac
tggctgatagatgtaagagcccagaacgatctcttcagcacatcaggcaatgagtgggtc
ctgctgaacctcaatgtgacgggctattaccgggtgaactacgacgaagagaactggagg
aagattcagactcagctgcagagagaccactcggccatccctgtcatcaatcgggcacag
atcattaatgacgccttcaacctggccagtgcccataaggtccctgtcactctggcgctg
aacaacaccctcttcctgattgaagagagacagtacatgccctgggaggccgccctgagc
agcctgagctacttcaagctcatgtttgaccgctccgaggtctatggccccatgaagaac
tacctgaagaagcaggtcacacccctcttcattcacttcagaaataataccaacaactgg
agggagatcccagaaaacctgatggaccagtacagcgaggttaatgccatcagcaccgcc
tgctccaacggagttccagagtgtgaggagatggtctctggccttttcaagcagtggatg
gagaaccccaataataacccgatccaccccaacctgcggtccaccgtctactgcaacgct
atcgcccagggcggggaggaggagtgggacttcgcctgggagcagttccgaaatgccaca
ctggtcaatgaggctgacaagctccgggcagccctggcctgcagcaaagagttgtggatc
ctgaacaggtacctgagctacaccctgaacccggacttaatccggaagcaggacgccacc
tctaccatcatcagcattaccaacaacgtcattgggcaaggtctggtctgggactttgtc
cagagcaactggaagaagctttttaacgattatggtggtggctcgttctccttctccaac
ctcatccaggcagtgacacgacgattctccaccgagtatgagctgcagcagctggagcag
ttcaagaaggacaacgaggaaacaggcttcggctcaggcacccgggccctggagcaagcc
ctggagaagacgaaagccaacatcaagtgggtgaaggagaacaaggaggtggtgctccag
tggttcacagaaaacagcaaatag

DBGET integrated database retrieval system