KEGG   Homo sapiens (human): 290Help
Entry
290               CDS       T01001                                 

Gene name
ANPEP, APN, CD13, GP150, LAP1, P150, PEPN
Definition
alanyl (membrane) aminopeptidase (EC:3.4.11.2)
Orthology
K11140  
aminopeptidase N [EC:3.4.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolic pathways
Renin-angiotensin system
Hematopoietic cell lineage
Drug target
Other: 
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q25-q26
AA seq 967 aa AA seqDB search
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggcttctatatttccaagtccctgggcatcctggggatcctcctgggcgtg
gcagccgtgtgcacaatcatcgcactgtcagtggtgtactcccaggagaagaacaagaac
gccaacagctcccccgtggcctccaccaccccgtccgcctcagccaccaccaaccccgcc
tcggccaccaccttggaccaaagtaaagcgtggaatcgttaccgcctccccaacacgctg
aaacccgattcctaccgggtgacgctgagaccgtacctcacccccaatgacaggggcctg
tacgtttttaagggctccagcaccgtccgtttcacctgcaaggaggccactgacgtcatc
atcatccacagcaagaagctcaactacaccctcagccaggggcacagggtggtcctgcgt
ggtgtgggaggctcccagccccccgacattgacaagactgagctggtggagcccaccgag
tacctggtggtgcacctcaagggctccctggtgaaggacagccagtatgagatggacagc
gagttcgagggggagttggcagatgacctggcgggcttctaccgcagcgagtacatggag
ggcaatgtcagaaaggtggtggccactacacagatgcaggctgcagatgcccggaagtcc
ttcccatgcttcgatgagccggccatgaaggccgagttcaacatcacgcttatccacccc
aaggacctgacagccctgtccaacatgcttcccaaaggtcccagcaccccacttccagaa
gaccccaactggaatgtcactgagttccacaccacgcccaagatgtccacgtacttgctg
gccttcattgtcagtgagttcgactacgtggagaagcaggcatccaatggtgtcttgatc
cggatctgggcccggcccagtgccattgcggcgggccacggcgattatgccctgaacgtg
acgggccccatccttaacttctttgctggtcattatgacacaccctacccactcccaaaa
tcagaccagattggcctgccagacttcaacgccggcgccatggagaactggggactggtg
acctaccgggagaactccctgctgttcgaccccctgtcctcctccagcagcaacaaggag
cgggtggtcactgtgattgctcatgagctggcccaccagtggttcgggaacctggtgacc
atagagtggtggaatgacctgtggctgaacgagggcttcgcctcctacgtggagtacctg
ggtgctgactatgcggagcccacctggaacttgaaagacctcatggtgctgaatgatgtg
taccgcgtgatggcagtggatgcactggcctcctcccacccgctgtccacacccgcctcg
gagatcaacacgccggcccagatcagtgagctgtttgacgccatctcctacagcaagggc
gcctcagtcctcaggatgctctccagcttcctgtccgaggacgtattcaagcagggcctg
gcgtcctacctccacacctttgcctaccagaacaccatctacctgaacctgtgggaccac
ctgcaggaggctgtgaacaaccggtccatccaactccccaccaccgtgcgggacatcatg
aaccgctggaccctgcagatgggcttcccggtcatcacggtggataccagcacggggacc
ctttcccaggagcacttcctccttgaccccgattccaatgttacccgcccctcagaattc
aactacgtgtggattgtgcccatcacatccatcagagatggcagacagcagcaggactac
tggctgatagatgtaagagcccagaacgatctcttcagcacatcaggcaatgagtgggtc
ctgctgaacctcaatgtgacgggctattaccgggtgaactacgacgaagagaactggagg
aagattcagactcagctgcagagagaccactcggccatccctgtcatcaatcgggcacag
atcattaatgacgccttcaacctggccagtgcccataaggtccctgtcactctggcgctg
aacaacaccctcttcctgattgaagagagacagtacatgccctgggaggccgccctgagc
agcctgagctacttcaagctcatgtttgaccgctccgaggtctatggccccatgaagaac
tacctgaagaagcaggtcacacccctcttcattcacttcagaaataataccaacaactgg
agggagatcccagaaaacctgatggaccagtacagcgaggttaatgccatcagcaccgcc
tgctccaacggagttccagagtgtgaggagatggtctctggccttttcaagcagtggatg
gagaaccccaataataacccgatccaccccaacctgcggtccaccgtctactgcaacgct
atcgcccagggcggggaggaggagtgggacttcgcctgggagcagttccgaaatgccaca
ctggtcaatgaggctgacaagctccgggcagccctggcctgcagcaaagagttgtggatc
ctgaacaggtacctgagctacaccctgaacccggacttaatccggaagcaggacgccacc
tctaccatcatcagcattaccaacaacgtcattgggcaaggtctggtctgggactttgtc
cagagcaactggaagaagctttttaacgattatggtggtggctcgttctccttctccaac
ctcatccaggcagtgacacgacgattctccaccgagtatgagctgcagcagctggagcag
ttcaagaaggacaacgaggaaacaggcttcggctcaggcacccgggccctggagcaagcc
ctggagaagacgaaagccaacatcaagtgggtgaaggagaacaaggaggtggtgctccag
tggttcacagaaaacagcaaatag

DBGET integrated database retrieval system