KEGG   Homo sapiens (human): 2900Help
Entry
2900              CDS       T01001                                 

Gene name
GRIK4, EAA1, GRIK, GluK4, KA1
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Drug target
Topiramate: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q22.3
AA seq 956 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcctgcgtggctcgtgatggtcgcctgc
agcccgcactccttgaggatcgctgctatcttggacgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgctgtcctcggaccatcgtccagc
ccagcctccagctccatcatcagcaacatctgtggagagaaggaggtccctcacttcaaa
gtggccccagaggagttcgtcaagttccagttccagagattcacaaccctgaacctccac
cccagcaacactgacatcagcgtggctgtagctgggatcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctagagaagctgctccgg
caattccttatctccaaggacacgctgtccgtccgcatgctggatgacacccgggacccc
accccgctcctcaaggagatccgggacgacaagaccgccaccatcatcatccacgccaac
gcctccatgtcccacaccatcctcctgaaggcagccgaacttgggatggtgtcagcctat
tacacatacatcttcactaatctggagttctcactccagagaatggacagccttgtggat
gatcgtgtcaacatcctgggattttccattttcaaccaatcccatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgtgaccatgtgcccttcactggg
cctgcgctctcctcggccctgctgtttgatgctgtctatgctgtggtgactgcggtgcag
gaactgaaccggagccaagagatcggcgtgaagcccttgtcctgcggctcggcccagatc
tggcagcacggcaccagcctcatgaactacctgcgcatggtagaattggaaggtcttacc
ggccacattgaattcaacagcaaaggccagaggtccaactacgctttgaaaatcttacag
ttcacaaggaatggttttcggcagatcggccagtggcacgtggcagagggcctcagcatg
gacagccacctctatgcctccaacatctcggacactctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccatatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccga
ttcaactacaagatccgcctggttggggatggcgtgtacggcgttcccgaggccaacggc
acctggacgggaatggtcggggagctgatcgctaggaaagcagatctggctgtggcaggc
ctcaccattacagctgaacgggagaaggtgattgatttctctaagccattcatgactctg
ggaattagcattctttaccgcgttcatatgggacgcaaacccggctatttctccttcctg
gacccattttctccgggcgtctggctcttcatgcttctagcctatctggccgtcagctgt
gtcctcttcctggtggctcggttgacgccctacgagtggtacagcccacacccatgtgcc
cagggccggtgcaacctcctggtgaaccagtactccctgggcaacagcctctggtttccg
gtcggggggttcatgcagcagggctccaccatcgcccctcgcgccttatccacccgctgt
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaacctg
gcagccttcctgaccgtgcagcgcatggatgtgcccattgagtcagtggatgacctggct
gaccagaccgccattgaatatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctaccagacctaccaacgcatgtggaattacatgtattccaagcagcccagc
gtgttcgtgaagagcacagaggagggaatcgccagggtgttgaattccaactacgccttc
ctcctggaatccaccatgaacgagtactatcggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggctcggttttccgg
gacgagtttgatctggccattctccagctgcaggagaacaaccgcctggagatcctgaag
cgcaaatggtgggaaggagggaagtgccccaaggaggaagatcacagagctaaaggcctg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggctatgttggagtttttatggactctcagacactcagaagcaactgaggtgtcc
gtctgccaggagatggtgaccgagctgcgcagcattatcctgtgtcaggacagtatccac
ccccgccggcggcgcgccgcagtcccgccgccccggccccccatccccgaggagcgccga
ccgcggggcacggcgacgctcagcaacgggaagctgtgcggggcaggggagcccgaccag
ctcgcgcagagactggcgcaggaggccgccctggtggcccgcggctgcacgcacatccgc
gtctgccccgagtgccgccgcttccagggcctgcgggcacggccgtcgcccgcccgcagc
gaggagagcctggagtgggagaaaaccaccaacagcagcgagcccgagtag

DBGET integrated database retrieval system