KEGG   Homo sapiens (human): 2901Help
Entry
2901              CDS       T01001                                 

Gene name
GRIK5, EAA2, GRIK2, GluK5, KA2
Definition
glutamate receptor, ionotropic, kainate 5
Orthology
K05205  
glutamate receptor, ionotropic kainate 5
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Drug target
Topiramate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2901 (GRIK5)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2901 (GRIK5)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   2901 (GRIK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 981 aa AA seqDB search
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEETP
ALHPAACQCSALGPRTPLKEPSMLLVKVPSTRVQVAFSRTSLRQVCPFLLQHQLSSLYWI
QATNVQICCHFSSLKPSPDLTFPPSHRPLSSLLFTALAAVGGLPDASSFFFPPISSCPPL
QSGIGPCHSTEATLVTSNFHV
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgagctgctgctgctgctgattgttgccttcgccagccccagctgccaggtg
ctctcatcactgcgcatggctgcaatcctggatgatcagacagtgtgtggccgcggtgag
cgtctggccttggccttggcccgggagcagatcaacgggatcatcgaggtcccagccaag
gcccgagtggaagtagacatctttgagctgcagcgggacagccagtacgagaccacggac
accatgtgtcagatcttacccaaaggggttgtgtctgtccttgggccctcctctagccca
gcatctgcctccaccgtgagccatatctgtggagagaaggagatcccccacatcaaggtg
ggtcccgaggagacaccccgccttcagtaccttcgcttcgcgtctgtcagcctgtacccc
agtaacgaggacgtcagcttggcggtctcccgaatcctcaagtccttcaactacccctcg
gccagcctcatctgcgccaaggctgagtgcctgctgcgattggaggaactggtgcgtggc
ttcctcatctccaaggagacgctgtcagtgaggatgttggacgacagccgggaccccaca
ccactgctcaaggagatccgtgatgacaaggtgtccaccatcatcatcgacgccaacgcc
tccatctcccacctcatcctccgtaaggcctcggaactgggaatgacctcagcgttttac
aagtacatcctcaccaccatggacttccccatcctgcatctggacggtattgtggaggac
tcctccaacatcctgggcttctccatgttcaacacgtcccaccccttctaccctgagttt
gtccgcagcctcaacatgtcctggagggagaactgtgaagccagcacctacctgggccct
gcgctgtcagccgccctgatgtttgacgccgtgcacgtggtggtgagcgctgtccgagag
ctgaaccgcagccaggagatcggtgtgaagcctctggcctgtacatcggccaacatttgg
ccccacgggaccagcctcatgaactacctgcgcatggtagagtatgatgggctgaccggg
cgggtcgagttcaacagcaaagggcagagaaccaactacaccctgcgcatcctagaaaag
tcccggcagggccaccgtgagattggggtgtggtactctaaccgcaccctggccatgaat
gccaccaccctggacatcaacctgtcgcagacactggccaacaagaccctggtggtcaca
accatcctggagaacccatacgtcatgcgccggcccaacttccaggccctgtcggggaac
gaacgcttcgagggcttctgcgtggacatgctgcgggagctggccgagctgctgcgcttc
cgctaccgcctgcggttggtggaggatgggctgtacggggcgcccgagcccaacggctcc
tggacgggcatggttggcgagctcatcaaccggaaggcagacctggctgtggccgccttc
accatcacagctgagcgggagaaggtcatcgacttttccaagccctttatgaccctgggg
atcagcatcctctaccgagtgcacatgggccgcaagcctggctacttctccttcctggac
cccttctcccctgctgtgtggctcttcatgcttcttgcctacctggctgtcagctgcgtc
ctgtttctggctgccaggctgagcccctatgagtggtataacccacacccatgcctgcgg
gcacgcccccacatcctggagaaccagtacacgctgggcaacagcctgtggtttcccgtg
gggggcttcatgcagcagggctcggagatcatgccccgggcgctgtccacgcgctgtgtc
agcggagtctggtgggccttcaccttgatcatcatctcctcctacacggccaacctggcc
gccttcctcaccgtgcagcgcatggaggtgcctgtggagtcggccgatgacctggcagat
cagaccaacatcgagtatggcaccatccacgccggctccaccatgaccttcttccagaat
tcacggtaccaaacgtaccagcgcatgtggaactacatgcagtcgaagcagcccagcgtg
ttcgtcaagagcacagaagagggcattgcccgcgtcctcaactcccgctacgccttcctg
ctcgagtccaccatgaacgaataccaccggcgcctcaactgcaacctcacccagatcggg
ggactcctcgacaccaagggctacggcattggcatgccgctgggctccccgttccgggat
gagatcacactggccatcctgcagcttcaggagaacaaccggctggagatcctgaagcgc
aagtggtgggaggggggccggtgccccaaggaggaggaccatcgagctaaaggtttgggc
atggagaacattggtggcatttttatcgtgctcatctgtggcctcatcattgctgtcttc
gtggcggtcatggaattcatatggtccacacggaggtcagctgagtccgaggagacccca
gctctgcatccagctgcctgccagtgttctgcacttggcccaaggactcctctgaaggag
ccgtccatgctgctagtaaaggtgccctccacccgtgtccaggttgccttctcaaggaca
tccctccggcaagtctgtcctttcctcctgcagcatcagttgtcctctctttattggatt
caggccaccaacgtacaaatatgctgtcatttctccagtcttaaaccctctcctgacctc
actttccctcccagccaccgcccactttcttcccttctctttacagccttggcagcagtg
gggggtctccctgatgcttccagtttcttctttcctcccatttcctcttgccccccactc
cagtctggcatcggtccctgccactccactgaagccactcttgtcaccagcaacttccat
gtctga

DBGET integrated database retrieval system