KEGG   Homo sapiens (human): 29015Help
Entry
29015             CDS       T01001                                 

Gene name
SLC43A3, EEG1, FOAP-13, PRO1659, SEEEG-1
Definition
(RefSeq) solute carrier family 43 member 3
  KO
K08230  
MFS transporter, LAT3 family, solute carrier family 43, member 3
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC43: Na+-independent, system-L-like amino acid transporter
   29015 (SLC43A3)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   L-Amino acid transporter-3 (LAT3) family (SLC43 family) [TC:2.A.1.44]
    29015 (SLC43A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q11
AA seq 491 aa AA seqDB search
MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQ
ADCKAQDERFSLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSA
GSAVLLFLAMPMLTIGGILFLITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLY
EKGISLRASFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAE
HENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRRFAWHLVWLSVIQLWHYLFIGTL
NSLLTNMAGGDMARVSTYTNAFAFTQFGVLCAPWNGLLMDRLKQKYQKEARKTGSSTLAV
ALCSTVPSLALTSLLCLGFALCASVPILPLQYLTFILQVISRSFLYGSNAAFLTLAFPSE
HFGKLFGLVMALSAVVSLLQFPIFTLIKGSLQNDPFYVNVMFMLAILLTFFHPFLVYREC
RTWKESPSAIA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccagggcctgcccctgcacgtggccacactgctgactgggctgctggaatgc
ctgggctttgctggcgtcctctttggctggccttcactagtgtttgtcttcaagaatgaa
gattactttaaggatctgtgtggaccagatgctgggccgattggcaatgccacagggcag
gctgactgcaaagcccaggatgagaggttctcactcatcttcaccctggggtccttcatg
aacaacttcatgacattccccactggctacatctttgaccggttcaagaccaccgtggca
cgcctcatagccatatttttctacaccaccgccacactcatcatagccttcacctctgca
ggctcagccgtgctgctcttcctggccatgccaatgctcaccattgggggaatcctgttt
ctcatcaccaacctgcagattgggaacctatttggccaacaccgttcgaccatcatcact
ctgtacaatggagcatttgactcttcctcggcagtcttccttattattaagcttctttat
gaaaaaggcatcagcctcagggcctccttcatcttcatctctgtctgcagtacctggcat
gtagcacgcactttcctcctgatgccccgggggcacatcccatacccactgccccccaac
tacagctatggcctgtgccctgggaatggcaccacaaaggaagagaaggaaacagctgag
catgaaaacagggagctacagtcaaaggagttcctttcagcgaaggaagagaccccaggg
gcagggcagaagcaggaactccgctccttctggagctacgctttctctcggcgctttgcc
tggcacctggtgtggctgtctgtgatacagttgtggcactacctcttcattggcactctc
aactccttgctgaccaacatggccggtggggacatggcacgagtcagcacctacacaaat
gcctttgccttcactcagttcggagtgctgtgtgccccctggaatggcctgctcatggac
cggcttaaacagaagtaccagaaggaagcaagaaagacaggttcctccactttggcggtg
gccctctgctcgacggtgccttcgctggccctgacatccctgctgtgcctgggcttcgcc
ctctgtgcctcagtccccatcctccctctccagtacctcaccttcatcctgcaagtgatc
agccgctccttcctctatgggagcaacgcggccttcctcacccttgctttcccttcagag
cactttggcaagctctttgggctggtgatggccttgtcggctgtggtgtctctgctccag
ttccccatcttcaccctcatcaaaggctcccttcagaatgacccattttacgtgaatgtg
atgttcatgcttgccattcttctgacattcttccacccctttctggtatatcgggaatgc
cgtacttggaaagaaagtccctctgcaattgcatag

DBGET integrated database retrieval system