KEGG   Homo sapiens (human): 29028Help
Entry
29028             CDS       T01001                                 

Gene name
ATAD2, ANCCA, CT137, PRO2000
Definition
(RefSeq) ATPase family, AAA domain containing 2 (EC:3.6.1.3)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.13
AA seq 1390 aa AA seqDB search
MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGS
SVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEE
HREDKVIPVTRSLRARNIVQSTEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNT
AEAVLQKMDDMKKMRRQRMRELEDLGVFNETEESNLNMYTRGKQKDIQRTDEETTDNQEG
SVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDDEDEEDGEEENQKRYYLRQRK
ATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSDS
TSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARAL
ANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVR
SSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPD
KEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYT
TSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL
QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHL
NRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPH
SALPEEVQELFIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLP
VAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD
YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACA
LRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSD
PEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIES
DTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILS
QPTPSLVVDHERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKME
QEVENFSCSR
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atggtggttctccgcagcagcttggagctgcacaaccactccgcggcctcggccacgggc
tccttggacctgtccagtgacttcctcagtctggagcacatcggccggaggcggctccgc
tcggccggcgcggcgcagaagaaacccgcggcgaccacagccaaagcgggcgatgggtca
tcagttaaggaagttgaaacctaccaccggacacgtgctttaagatctttgagaaaagat
gcacagaattcttcagattctagttttgagaagaatgtggaaataacggagcaacttgct
aatggcaggcattttacaaggcagttggccagacagcaggctgataaaaaaaaagaagag
cacagagaagacaaagtgattccagttactcggtcattgagggctagaaacatcgttcaa
agtacagaacacttacatgaagataatggtgatgttgaagtgcgtcgaagttgtaggatt
agaagtcgttatagtggtgtaaaccagtccatgctgtttgacaaacttataactaacact
gctgaagctgtacttcaaaaaatggatgacatgaagaagatgcgtagacagcgaatgaga
gaacttgaagacttgggagtgtttaatgaaacagaagaaagcaatcttaatatgtacaca
agaggaaaacagaaagatattcaaagaactgatgaagaaacaactgataatcaagaaggc
agtgtggagtcatctgaagagggtgaagaccaagaacatgaagatgatggtgaagatgaa
gatgatgaagatgatgatgatgatgacgatgatgatgatgatgatgatgatgaagatgat
gaagatgaagaagatggagaagaagagaatcagaagcgatattatcttagacagagaaaa
gctactgtttactatcaggctccattggaaaaacctcgtcaccagagaaagcccaacata
ttttatagtggcccagcttctcctgcaagaccaagataccgattatcttccgcaggacca
agaagtccttactgtaaacgaatgaacaggcgaaggcatgcaatccacagtagtgactcg
acttcatcttcctcctctgaagatgaacagcactttgagaggcggaggaaaaggagtcgt
aatagggctatcaataggtgcctcccactaaattttcggaaagatgaattaaaaggcatt
tataaagatcgaatgaaaattggagcaagccttgccgatgttgatccaatgcaactagat
tcttcagtacgatttgatagtgttggtggcctgtctaatcatatagcagctctaaaagag
atggtggtgtttccattactttatccagaagtctttgaaaaatttaaaattcaaccccca
agaggttgtttgttttatgggccacctggaactggaaagactctggttgccagagcactt
gccaatgagtgcagtcaaggggataaaagagtagcatttttcatgaggaaaggtgctgat
tgtctaagtaaatgggtaggagaatctgaaagacagctacgattgctgtttgatcaggcc
tatcagatgcgcccatcaattattttttttgacgaaattgatggtctggctccagtacgg
tcaagcaggcaagatcagattcacagttctattgtttccaccctgctagctcttatggat
ggattggacagcagaggggaaattgtggtcattggtgctacgaacaggctagattctata
gatcctgctttacgaaggcctggtcgctttgatagagaattcctctttagcctgcctgat
aaagaggctcgaaaagagattctaaagattcacaccagggattggaatcccaaaccactg
gacacatttttagaagagctagcagaaaactgtgttggatactgtggagcagatattaaa
tcaatatgtgctgaagctgctttatgtgctttacgacgacgctacccacagatctatacc
actagtgagaaactgcagttggatctctcttcaattaatatctcagctaaggatttcgag
gtagctatgcaaaagatgataccagcctcccaaagagctgtgacatcacctgggcaggca
ctgtccaccgttgtgaaaccactcctgcaaaacactgttgacaagattttagaagccctg
cagagagtatttccacatgcagaattcagaacaaataaaacattagactcagatatttct
tgtcctctgctagaaagtgacttggcttacagtgatgatgatgttccatcagtttatgaa
aatggactttctcagaaatcttctcataaggcaaaagacaattttaattttcttcatttg
aatagaaatgcttgttaccaacctatgtcttttcgaccaagaatattgatagtaggagaa
ccaggatttgggcaaggttctcacttggcaccagctgtcattcatgctttggaaaagttt
actgtatatacattagacattcctgttctttttggagttagtactacatcccctgaagaa
acatgtgcccaggtgattcgtgaagctaagagaacagcaccaagtatagtgtatgttcct
catatccacgtgtggtgggaaatagttggaccgacacttaaagccacatttaccacatta
ttacagaatattccttcatttgctccagttttactacttgcaacttctgacaaaccccat
tccgctttgccagaagaggtgcaagaattgtttatccgtgattatggagagatttttaat
gtccagttaccggataaagaagaacggacaaaattttttgaagatttaattctaaaacaa
gctgctaagcctcctatatcaaaaaagaaagcagttttgcaggctttggaggtactccca
gtagcaccaccacctgagccaagatcactgacagcagaagaagtgaaacgactagaagaa
caagaagaagatacatttagagaactgaggattttcttaagaaatgttacacataggctt
gctattgacaagcgattccgagtgtttactaagcctgttgaccctgatgaggttcctgat
tatgtcactgtaataaagcaaccaatggacctttcatctgtaatcagtaaaattgatcta
cacaagtatctgactgtgaaagactatttgagagatattgatctaatctgtagtaatgcc
ttagaatacaatccagatagagatcctggagatcgtcttattaggcatagagcctgtgct
ttaagagatactgcctatgccataattaaagaagaacttgatgaagactttgagcagctc
tgtgaagaaattcaggaatctagaaagaaaagaggttgtagctcctccaaatatgccccg
tcttactaccatgtgatgccaaagcaaaattccactcttgttggtgataaaagatcagac
ccagagcagaatgaaaagctaaagacaccgagtactcctgtggcttgcagcactcctgct
cagttgaagaggaaaattcgcaaaaagtcaaactggtacttaggcaccataaaaaagcga
aggaagatttcacaggcaaaggatgatagccagaatgccatagatcacaaaattgagagt
gatacagaggaaactcaagacacaagtgtagatcataatgagaccggaaacacaggagag
tcttcggtggaagaaaatgaaaaacagcaaaatgcctctgaaagcaaactggaattgaga
aataattcaaatacttgtaatatagagaatgagcttgaagactctaggaagactacagca
tgtacagaattgagagacaagattgcttgtaatggagatgcttctagctctcagataata
catatttctgatgaaaatgaaggaaaagaaatgtgtgttctgcgaatgactcgagctaga
cgttcccaggtagaacagcagcagctcatcactgttgaaaaggctttggcaattctttct
cagcctacaccctcacttgttgtggatcatgagcgattaaaaaatcttttgaagactgtt
gttaaaaaaagtcaaaactacaacatatttcagttggaaaatttgtatgcagtaatcagc
caatgtatttatcggcatcgcaaggaccatgataaaacatcacttattcagaaaatggag
caagaggtagaaaacttcagttgttccagatga

DBGET integrated database retrieval system