KEGG   Homo sapiens (human): 29035Help
Entry
29035             CDS       T01001                                 

Gene name
C16orf72, PRO0149
Definition
(RefSeq) chromosome 16 open reading frame 72
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
16p13.2
AA seq 275 aa AA seqDB search
MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLW
HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcggaaggaggagggcgaggccgagatccaggagcacgggcccgagcactgg
ttctccaagtgggagcggcagtgcctggccgaggccgaacaggacgagcagctgcccccc
gagctgcaggaggaggcggcggccgccgcgcagcccgagcacaagcagcagaagctgtgg
cacctcttccagaactcggccaccgccgtggcccagctctacaaagaccgagtgtgtcag
cagccaggactttctctctgggtccccttccaaaacgcagccaccgccgtcaccaatctc
tacaaagaaagcgtggatacccatcaacgaagttttgatattggaattcagattggctat
cagcgacgcaataaggatgtgttggcttgggttaaaaaacgcagaagaactattcgtcga
gaagatttgatcagcttcctgtgtggaaaagttcctccaccacgaaactctagagctccc
ccaagactgactgtagtgtcccctaaccgagctacttcaacggaaactagctcatctgta
gagactgatttgcaacccttccgggaagccatagctctgcatggtcttagtggtgcaatg
gctagtataagcgtgcgttcgagtaccccaggctctcctacacatgtaagcagtggatcg
aatgctagtcgaaggagaaatggactccatgatgtcgatttgaacactttcatatcagaa
gaaatggcactccacttggacaatggtggaactagaaagcgtacctcagcccagtgtggc
gatgtcattacagactcaccaacccataaacgcaacagaatgatctaa

DBGET integrated database retrieval system