KEGG   Homo sapiens (human): 2905Help
Entry
2905              CDS       T01001                                 

Gene name
GRIN2C, GluN2C, NMDAR2C, NR2C
Definition
glutamate receptor, ionotropic, N-methyl D-aspartate 2C
Orthology
K05211  
glutamate receptor ionotropic, NMDA 2C
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Drug target
Ketamine: 
Esketamine: 
Ketobemidone: 
Flupirtine: 
Memantine: 
Acamprosate: 
Methadone: 
Levomethadone: 
Dextromethorphan, combinations: 
Dextromethorphan: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2905 (GRIN2C)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2905 (GRIN2C)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2905 (GRIN2C)
   04720 Long-term potentiation
    2905 (GRIN2C)
  Environmental adaptation
   04713 Circadian entrainment
    2905 (GRIN2C)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2905 (GRIN2C)
   05014 Amyotrophic lateral sclerosis (ALS)
    2905 (GRIN2C)
  Substance dependence
   05030 Cocaine addiction
    2905 (GRIN2C)
   05031 Amphetamine addiction
    2905 (GRIN2C)
   05033 Nicotine addiction
    2905 (GRIN2C)
   05034 Alcoholism
    2905 (GRIN2C)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   2905 (GRIN2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 1233 aa AA seqDB search
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPAFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFSGVQSLASPPRQASPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTGW
GPPDGGRAALVRRAPQPPGRPPTPGPPLSDVSRVSRRPAWEARWPVRTGHCGRHLSASER
PLSPARCHYSSFPRADRSGRPFLPLFPELEDLPLLGPEQLARREALLHAAWARGSRPRHA
SLPSSVAEAFARPSSLPAGCTGPACARPDGHSACRRLAQAQSMCLPIYREACQEGEQAGA
PAWQHRQHVCLHAHAHLPFCWGAVCPHLPPCASHGSWLSGAWGPLGHRGRTLGLGTGYRD
SGGLDEISRVARGTQGFPGPCTWRRISSLESEV
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgggtggggccctggggccggccctgttgctcacctcgctcttcggtgcctgggcaggg
ctgggtccggggcagggcgagcagggcatgacggtggccgtggtgtttagcagctcaggg
ccgccccaggcccagttccgtgcccgcctcaccccccagagcttcctggacctacccctg
gagatccagccgctcacagttggggtcaacaccaccaaccccagcagcctcctcacccag
atctgcggcctcctgggtgctgcccacgtccacggcattgtctttgaggacaacgtggac
accgaggcggtggcccagatccttgacttcatctcctcccagacccatgtgcccatcctc
agcatcagcggaggctctgctgtggtcctcacccccaaggagccgggctccgccttcctg
cagctgggcgtgtccctggagcagcagctgcaggtgctgttcaaggtgctggaagagtac
gactggagcgccttcgccgtcatcaccagcctgcacccgggccacgcgctcttcctggag
ggcgtgcgcgccgtcgccgacgccagccacgtgagttggcggctgctggacgtggtcacg
ctggagctgggcccgggagggccgcgcgcgcgcacgcagcgcctgctgcgccagctcgac
gcgcccgtgtttgtggcctactgctcgcgcgaggaggccgaggtgctcttcgccgaggcg
gcgcaggccggtctggtggggcccggccacgtgtggctggtgcccaacctggcgctgggc
agcaccgatgcgccccccgccaccttccccgtgggcctcatcagcgtcgtcaccgagagc
tggcgcctcagcctgcgccagaaggtgcgcgacggcgtggccattctggccctgggcgcc
cacagctactggcgccagcatggaaccctgccagccccggccggggactgccgtgttcac
cctgggcccgtcagccctgcccgggaggccttctacaggcacctactgaatgtcacctgg
gagggccgagacttctccttcagccctggtgggtacctggtccagcccaccatggtggtg
atcgccctcaaccggcaccgcctctgggagatggtggggcgctgggagcatggcgtccta
tacatgaagtaccccgtgtggcctcgctacagtgcctctctgcagcctgtggtggacagt
cggcacctgacggtggccacgctggaagagcggccctttgtcatcgtggagagccctgac
cctggcacaggaggctgtgtccccaacaccgtgccctgccgcaggcagagcaaccacacc
ttcagcagcggggacgtggccccctacaccaagctctgctgtaagggattctgcatcgac
atcctcaagaagctggccagagtggtcaaattctcctacgacctgtacctggtgaccaac
ggcaagcatggcaagcgggtgcgcggcgtatggaacggcatgattggggaggtgtactac
aagcgggcagacatggccatcggctccctcaccatcaatgaggaacgctccgagatcgta
gacttctctgtaccctttgtggagacgggcatcagtgtgatggtggctcgcagcaatggc
accgtctccccctcggccttcttggagccatatagccctgcagtgtgggtgatgatgttt
gtcatgtgcctcactgtggtggccatcaccgtcttcatgttcgagtacttcagccctgtc
agctacaaccagaacctcaccagaggcaagaagtccgggggcccagctttcactatcggc
aagtccgtgtggctgctgtgggcgctggtcttcaacaactcagtgcccatcgagaacccg
cggggcaccaccagcaagatcatggttctggtctgggccttctttgctgtcatcttcctc
gccagctacacggccaacctggccgccttcatgatccaagagcaatacatcgacactgtg
tcgggcctcagtgacaagaagtttcagcggcctcaagatcagtacccacctttccgcttc
ggcacggtgcccaacggcagcacggagcggaacatccgcagtaactaccgtgacatgcac
acccacatggtcaagttcaaccagcgctcggtggaggacgcgctcaccagcctcaagatg
gggaagctggatgccttcatctatgatgctgctgtcctcaactacatggcaggcaaggac
gagggctgcaagctggtcaccattgggtctggcaaggtctttgctaccactggctacggc
atcgccatgcagaaggactcccactggaagcgggccatagacctggcgctcttgcagttc
ctgggggacggagagacacagaaactggagacagtgtggctctcagggatctgccagaat
gagaagaacgaggtgatgagcagcaagctggacatcgacaacatggcaggcgtcttctac
atgctgctggtggccatggggctggccctgctggtcttcgcctgggagcacctggtctac
tggaagctgcgccactcggtgcccaactcatcccagctggacttcctgctggctttcagc
aggggcatctacagctgcttcagcggggtgcagagcctcgccagcccaccgcggcaggcc
agcccggacctcacggccagctcggcccaggccagcgtgctcaagatgctgcaggcagcc
cgcgacatggtgaccacggcgggcgtaagcagctccctggaccgcgccactcgcaccatc
gagaattggggtggcggccgccgtgcgcccccaccgtccccctgcccgaccccgcggtct
ggccccagcccatgcctgcccacccccgacccgcccccagagccgagccccacgggctgg
ggaccgccagacgggggtcgcgcggcgcttgtgcgcagggctccgcagcccccgggccgc
cccccgacgccggggccgcccctgtccgacgtctcccgagtgtcgcgccgcccagcctgg
gaggcgcggtggccggtgcggaccgggcactgcgggaggcacctctcggcctccgagcgg
cccctgtcgcccgcgcgctgtcactacagctcctttcctcgagccgaccgatccggccgc
cccttcctcccgctcttcccggagctggaggacctgccgctgctcggtccggagcagctg
gcccggcgggaggccctgctgcacgcggcctgggcccggggctcgcgcccgcgtcacgct
tccctgcccagctccgtggccgaggccttcgctcggcccagctcgctgcccgctgggtgc
accggccccgcctgcgcccgccccgacggccactcggcctgcaggcgcttggcgcaggcg
cagtcgatgtgcttgccgatctaccgggaggcctgccaggagggcgagcaggcaggggcc
cccgcctggcagcacagacagcacgtctgcctgcacgcccacgcccacctgccattttgc
tggggggctgtctgtcctcaccttccaccctgtgccagccacggctcctggctctccggg
gcctgggggcctctggggcacaggggcaggactctggggctgggcacaggctacagagac
agtgggggactggacgagatcagcagggtagcccgtgggacgcaaggcttcccgggaccc
tgcacctggagacggatctccagtctggagtcagaagtgtga

DBGET integrated database retrieval system